KEGG   Parus major (Great Tit): 107198877Help
Entry
107198877         CDS       T04864                                 

Gene name
HDAC6
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmaj01009]
    107198877 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pmaj03019]
    107198877 (HDAC6)
   04131 Membrane trafficking [BR:pmaj04131]
    107198877 (HDAC6)
   03036 Chromosome and associated proteins [BR:pmaj03036]
    107198877 (HDAC6)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107198877 (HDAC6)
Protein phosphatases and associated proteins [BR:pmaj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107198877 (HDAC6)
Messenger RNA biogenesis [BR:pmaj03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107198877 (HDAC6)
Membrane trafficking [BR:pmaj04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107198877 (HDAC6)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107198877 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 107198877
NCBI-ProteinID: XP_015471614
LinkDB All DBs
Position
Unknown
AA seq 938 aa AA seqDB search
LGSFWGCPSPWGSLWEGGALGCPRTLHAPPPPRPEQDLGAEVAAPTGTGLVSDGGDRAEC
GDSCPPGGLAPLWAALEGLVQRCVPVQCRPATDEELLLVHSPSFVAQLEPPDSPGLGGSG
PRRAVGAAVALLEQVLGGALRNGVALISPQDPQDSPEPAAVAARVAQKHLGVQRVLIVDW
SPQPGRSLPRLFQEDPSVLYFGAQRGREPPPSPGHGPGEGFSVELRWEQSLGRVLGSLCR
TRGPCGDLGVPSCCDPAVAPQFQPQLVLVEASLEDLGGSLGVSPAGFSLLTHLLSALGRG
RLLLLLQRPGQHCPHPEHPPAVLGLPAERRDRRGGGGGGGGGERREEEAEAEAGEEEEEN
EDEDEGKEELEGDGNPPETPPEPPPRARVGLVYDPRMEEHRNTWDSQHPECPQRLSRVLQ
RLQELGLAQRCLPLPSRPATPRQLHACHTRAHVRTLSRTPSLSPRELRALSQRYNSLYLC
PQSYSCARLAAGGACAAVGAVLGGQVRSALAVLRPPGHHARPGSAGGFCLFNNVGVAVRH
AQRLAGTPLRVLILDWDIHHGNGTQEIFEEDPSVLYMSLHRHDGSFFPGGAGGSPRRRGR
GPGTGFTLNVGWGGPRVGDPEYLAALTRLVLPVACQFGPELVLVSAGFDAGRGDPLGGCL
VSPQTFGLMTHLLGGLAGGRLVLVLEGGYNLAVTAEGVGQCLGVLLGDPPTLPPPGTPQP
VALRALSRTLRAQRGSWSCLQLPRVEPPKEGHGSDDVTSTADDVTGSPPLDAAIRRLGAL
QLGDAPGGGAKAGSGAGPPLGHAPAAAAAPCWEEEEELEEGALYAVTPLLDCPHLGAVAP
PPAEGALGDILPPPCGVCGSRRENWLCLSCHQVLCGRYVGGHMLEHGGASGHPLVLSLRD
LAAWCYPCGGYVTHPVLLPTKTFIYHLKFGTDPPTASF
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
cttgggtccttttgggggtgtcccagtccttggggatccctttgggaggggggggccctg
gggtgtcccaggaccctccatgccccccctcctccccgccccgagcaggatttgggggca
gaggtcgcagctcccactggaacaggactggtcagtgatggaggggacagagccgagtgc
ggggacagctgcccccccgggggtctggccccgctctgggcggcgctggaggggctggtc
cagcgctgcgtccctgtgcagtgccgcccagccaccgatgaggagctgctgctggtgcac
agcccctcgttcgtggcgcagctggagccccccgacagccccggcctgggggggtcgggg
ccccgccgggccgtgggggcggcagtggcgctgctggagcaggtgctggggggtgccctg
cgcaatggggtggccctgatcagcccccaggacccccaggattcccccgagcccgcggcc
gtggccgcccgggtggcccagaaacacctcggggtgcagcgtgtcctgatcgtggattgg
agcccccagcccggccggagcctccctcggctgttccaggaggatcccagtgtcctgtac
ttcggggctcagcggggccgggagccgccccccagccctggccacggccccggggaggga
ttcagcgtggagctgcgctgggagcagtccctgggcagggttttggggtccctgtgtagg
actcgaggtccctgtggggatttgggggtcccatcgtgctgtgaccctgcggtggctcct
cagttccagccccagctcgtcctggtcgaggcttcgctggaggatttgggggggtccctg
ggggtctcccctgctgggttctctctcctgacccacctgctctcggccctggggaggggg
cggctgctgctgctgctgcagcggcctggccagcattgcccgcaccctgagcatccacca
gcagtactggggctgcctgcagagcgccgagatcgaagaggaggaggaggaggaggagga
ggaggagaaagaagagaggaagaagcagaggcagaagcaggggaagaagaggaggagaac
gaggatgaggatgaaggaaaggaggagctggagggggatgggaaccccccagagaccccc
ccggagccaccgccaagagcccgagtggggttggtctacgacccccgcatggaggagcac
aggaacacctgggacagccagcaccccgagtgcccgcagcgcctgtcgcgggtgctgcag
cgcctgcaggagctggggctggcccagcgctgcctcccgctgccctcccggcccgcgacc
ccccggcagctccacgcctgccacacccgtgcccacgtgcggacgctgtcccggacgccg
tcgctgtccccgcgggagctgcgggcgctgtcccagcgctacaacagcctctacctgtgc
ccccagtcctacagctgtgcccgcctggccgcgggcggggcctgcgccgctgtgggggcc
gtgctggggggccaggtgcgctcggcgctggccgtgctgcgtccccccggccaccacgcc
cgccccggctctgccgggggcttctgcctcttcaacaacgtgggggtggccgtgcgccac
gcccagcgcctggcagggacccccctcagggtgctgatcctagactgggacattcaccac
ggcaacggcacccaggagatcttcgaagaggaccccagtgtcctgtacatgtccctgcac
cgccatgacggctccttcttcccggggggggccggggggtccccgaggcgccgggggagg
ggtcctggcaccggcttcaccctgaacgttggctggggggggccccgcgtgggggacccc
gagtacctggcggccctgacccgcctggtgctgccggtggcctgccagtttgggccagag
ctggtgctggtgtcggccgggttcgacgcgggccggggggaccccctgggggggtgcctg
gtgtccccccagaccttcggcctcatgacccatctgctgggggggctggcggggggacgg
ctcgtgcttgtgcttgagggcgggtacaacctggcagtgacggcagagggggtggggcag
tgcctgggggtcctgcttggggacccccccacactgcccccccccgggaccccccagcca
gtggcgctgagggccctgagccgcaccctgcgagcccagcggggctcctggagctgcctg
cagctgcctcgtgttgagccccccaaggaggggcacggcagcgatgatgtcacatccacc
gccgatgacgtcaccggttcgcccccgctggacgccgccattcgccgcttgggggcgctg
cagctcggggacgcgccggggggcggggccaaagctggctcgggggcggggcctccgctg
ggccacgcccccgctgccgctgccgccccctgctgggaggaggaggaagagctggaggag
ggagcgctgtacgccgtgacgcccctcctggactgtccccacctgggggccgtggccccc
cctccggccgagggggctctcggggacatcctgccccccccctgcggggtctgcgggagc
cgccgcgagaattggctgtgcctgagctgccaccaggtgctgtgtgggcgctacgtcggg
gggcacatgctggaacacgggggggcctcggggcaccccctggtgctgagcctgcgggac
ctggcggcctggtgctacccctgcgggggctacgtcacccacccggtgctgctccccacc
aagaccttcatctaccacctcaaattcggcactgacccccccaccgcctccttctga

DBGET integrated database retrieval system