KEGG   Parus major (Great Tit): 107198914Help
Entry
107198914         CDS       T04864                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107198914
   00500 Starch and sucrose metabolism
    107198914
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107198914
    3.2.1.20  alpha-glucosidase
     107198914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107198914
NCBI-ProteinID: XP_015471670
LinkDB All DBs
Position
Unknown
AA seq 1810 aa AA seqDB search
MGQWSRLELALGALFLVAVAVAGVLLGILGTWDPKSREIRFSPRCPNVSLAERLDCIPDH
AATKSLCERRGCCWSPLSEPGVPWCFFSSEHGYRLESGPHTTTQGPEVFLRRLPSPSLFG
AAADLVRLRAQLQSSARLRLQFTNPEKQQFEVPHDHIGPFSGPATSDPKYQLKFQENPFG
IQVIRASTGKVIFDTTIGPLVFSEQFLQISTRIPSSNVYGLGEHLHRSFRHDLRWKTWPL
FSRHAAPSASVENLAGVHTFFLCLEDNSGASMGVFLMNSNAMEVALTPAPAVTFRTIGGI
LDFYIFLGDTPEQVVQEYVQFIGLPALPPYWALGFQLSHRSYGSLDEVKAVVERNRAIGL
PYDVQYTDIDAMDGCKDFTYDKIKFHDLPNFREFLSAAEQKFVIVLDAAIAMEPMADGSP
YRTFERGQEKRVWVNESDGVTPLIGEARPGQVVFPDFSNPVCVEWWEQEFQRFHELIPYD
GIWIDMNEAACFIPGSTRGCTDSTWNFPPYTPRVADWPLFRRSLCLDAVQSWGRQYDVHS
LYGHSMALATLRALGRLSPGRRSFLVSGSTFAGSGRLGGHWLGDNAATWDHLRWATPALL
EFGLFGIPYVGAAICGSLGAAPEELCRRWMQLGAFYPLARNHNHESSTPQDPAAFGANSV
LVNSSRHYLSIRYHLLPYLYSLFYRAHTRGDTVARPLLHEFYAEEATWDVNGQFLWGPGL
LITPVLEPGVEVISAYIPDAVWYEYETGSRLWMRKQWTHLYLPADKLGLHLRGGHIFPVQ
HPATTTAASRRNPMGLIVALDENQEAMGELFWDDGESADTVSSKSYIFYNFWFSKNVLEL
SVAHNNFSEPHGLEFQELRVLGLRQAPLAITVTSSKAAVPSPHNLTYDAATQVAIVQGLR
LRLGQSYSLHWTLGTRDSDRFDCHPAEGASRESCERLGCIWNENTSGVRVPYCHYNGSDN
GYSASDIRYSPTGATATVTLERRGHASTAAATIPIETLGLEVTFHMDHLLQFKIYDPATQ
RYEVPVPLSLPGTPQASVQRRLYDVTIQERPFGVQVRRRSSGTVIWDSQLPTFVFSDQFL
QISTRLPAPFVFGFGEAEHDAFRHNLDWHTWGMFTRDQPPGYKLNSYGFQPFYMGLEKDG
NAHGVLLLNSNAMDVTFQPTPALTYRTVGGILDFYLVLGPTPEEVVQEYTELVGRPVMPA
YWALGFQLCRYGYENDAEIAQLVNDMNQAQIPLDVQYADIDYMERQLDFTLSPRFQGLPE
LVRRIQSNGMRFILILDPAISANETNYPAYDRGVQQDVFIKWPDSDDLVYAKVWPDLPNV
VVNDSLDWDTQVELYRAFAAMPDFFRNSTRDWWAQEIAEVYENPRNSSLSIKFDGLWIDM
NEPSSFVHGTIGGCRDRNLNFPPYMPQLGSRSEGLSFKTICMEGQQQLPDGSPVRHYDVH
NLYGWAQTKPTLDILRNLTGERGIVVTRSTFPSSGRWAGHWLGDNTAAWNQLDKSIIGMM
EFSLFGISYSGADICGFFGEPSYELCARWMELGAFYPYSRNHNGNKAKRQDPVAWNSTFA
DLSRAVLQLRYRLLPHLYTLMLHAHVRGSTVVRPLLHEFVEDRTTWDIYRQFMWGAGLLI
SPVLEPGVSEVRAYLPDARWFNFHTDEEVVFRRQFQNFPAPLGHINLHVRGGHILPQQLP
ANNTWFSRQNPLLLTVALDDAQEASGNLYWDDGVGIDTFEKGEYLMMSFTASSNILELRV
LHGGYMDPNSLKFTEIKVLGVPGSIQEVTVTRDGLDVPSPHAVAHDPQKQVLKITQLELE
LGQNYTLKWA
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atggggcagtggagccgcctggagctggcgctgggcgcgctgttcctggtggccgtggcc
gtggccggagtcctgctgggcatcctggggacgtgggaccccaaatcccgggaaatccgt
ttttcccctcggtgcccaaatgtatccctggccgagcgcctcgactgcatccctgaccat
gcagccaccaagagtctgtgcgaacgccgcggctgctgctggagcccgctcagcgagccc
ggggtgccctggtgtttcttctcctctgagcacggctaccggctggagagcggcccccac
accacgacccagggccccgaggtgttcctgcgccgtctcccttccccgtcgctcttcggg
gcagccgcggacctcgtgcggctccgggcacagctccagagctccgcgcggctccgcctg
cagttcaccaaccccgaaaagcagcagtttgaggtcccccacgaccacattgggcccttt
tctggccccgccacctctgaccccaaatatcagctgaaattccaggaaaatccctttggg
atccaggttatccgagccagcaccggcaaagtcatattcgacaccaccatcggccccttg
gtgttttctgagcaattcctgcagatttccacccgaattcccagctccaacgtctatggc
ctgggggagcatctccaccggagcttccggcacgatctgcgctggaaaacctggcccctc
ttcagccgccacgccgccccctctgctagtgtggagaacttggccggagtacatacattt
ttcctctgtttggaagacaattctggagcttccatgggtgttttcctgatgaacagcaat
gccatggaggtggcactgactccggctcctgccgtcactttccggacaatcggaggaatc
ttggatttttacatctttttgggggacacacccgagcaggtggtgcaggaatatgtccag
tttatcgggctgcccgccctcccaccatattgggcactgggattccagctcagccaccgc
agttacggatccctggatgaggtgaaggctgtggtggagcggaaccgggcaattgggctg
ccctatgacgtgcagtacactgacatcgatgccatggacgggtgcaaggatttcacctac
gacaaaatcaaattccacgatcttcccaatttccgcgaattcctgagtgccgctgagcag
aaattcgtcattgtcctggatgccgccatcgctatggagccaatggcagacgggagcccc
tacaggaccttcgagagaggccaggagaaacgggtgtgggtcaacgagtctgatggcgtc
acaccgctaattggggaggcacggccaggccaggtggttttcccagatttctccaacccc
gtgtgtgtggagtggtgggagcaggaattccaaaggttccatgagctcatcccctacgac
ggcatctggatcgacatgaacgaggctgcgtgcttcatccctggatccaccagaggctgc
actgacagcacatggaactttcccccctacaccccccgcgtggctgactggccgctcttc
agacggtcactctgcctggatgctgtccagtcctggggccggcagtatgacgtgcacagc
ctgtatggccactccatggcactggcaacgctccgggctctaggccggttgtccccaggg
cgccgcagcttcctggtgtccggctcaacctttgcgggctccggacgcctcggtggccac
tggctcggggacaacgcagccacttgggaccatctgcgatgggctacccctgctctgctg
gaatttggcctctttgggatcccctatgtgggggcggccatctgtgggtccttgggagca
gctccggaggaactttgccggcgctggatgcagcttggggccttttaccccttagccagg
aaccacaaccacgagagcagcacaccacaggatccagctgcattcggtgccaactcagtg
ctggtgaactcatcccgacactacctgagcatccggtaccacctgttgccctacctgtat
tcactgttctaccgtgcccatacccgtggagataccgtggctcgaccactgctgcatgag
ttttacgctgaggaggccacatgggacgtgaatgggcagttcctatggggtccagggctc
ctcatcacccctgtgctcgagcccggtgtggaggtgatctcggcttacattcccgacgct
gtctggtatgagtacgagacgggctccaggctgtggatgcggaagcagtggactcacctg
tacctgcctgcagacaagctggggctgcacctgcgcgggggccacatcttccccgtgcag
cacccggccaccaccacagctgccagccgcaggaatcccatggggctcatcgtggcactg
gatgagaaccaggaggcaatgggggagcttttttgggatgacggagaatctgcagatact
gtgagcagcaaatcatacattttctacaacttctggttttccaaaaatgtgctggagctg
tcagtggcccacaacaacttctcagagcctcatgggctggagttccaggaactgcgcgtg
ctggggctacggcaggcgccactggccatcaccgtgacgtccagcaaagccgctgtccca
tcgccccacaatctcacctatgacgctgccacacaggtcgccatagtccaggggttgcgg
ctgcgcctcggccaatcctacagcctgcactggacactggggacacgggacagtgaccgc
tttgattgtcatcccgccgagggtgcgtcccgtgagagctgtgagcgccttggctgcatc
tggaatgaaaatacctcaggcgtccgtgtcccctactgccactacaacggctccgataac
ggttactctgcctcagacatcaggtactcgcccaccggagccacggccaccgtgacccta
gagcgccgtggccacgccagcaccgctgcggccaccatacccattgagaccctgggccta
gaggtgaccttccacatggaccacctgctgcaattcaagatttacgaccctgccactcag
cggtacgaggttccagtgccactctcactcccgggcaccccccaggcctcagttcagcgc
cgcctctatgatgtcaccatccaggagcgaccctttggggtccaggtgcggcgccgcagc
agtggcaccgtcatctgggactcacagttgccgacattcgtgttcagtgaccaattcctg
cagatctccacacgcctcccagcaccgtttgtgtttggcttcggcgaggctgagcacgac
gccttccgccacaacctggattggcacacctggggcatgttcactcgcgaccagcccccc
ggctacaagttgaattcctatggtttccaacctttctacatggggctggaaaaggacggc
aatgctcacggtgtcctgctgctcaacagtaacgccatggatgtcactttccagccaacc
ccagccctcacctaccgcactgttggtggcatcctggatttctatctggtcctagggcca
actcctgaggaagtggtgcaggaatacacagagctggtgggacgcccagtaatgcctgcc
tattgggctctgggcttccaactctgccgctatggctatgaaaatgatgccgaaattgcc
cagttggtcaatgacatgaaccaagcccagatccctctggatgtgcagtatgctgacatt
gattacatggagcgccagctggacttcacgctcagcccacgcttccaggggctcccagag
ctcgtgcggcgcatccagagcaacgggatgcgcttcatcctcattctggacccagccatc
tcagccaacgagactaattacccagcctatgatcgtggggtgcagcaggatgtcttcatc
aagtggcctgatagtgatgaccttgtctacgccaaggtgtggccggacctgcccaacgtg
gtggtcaacgattccctggattgggacacccaagtggagctgtatcgagcctttgctgcc
atgccagattttttccggaactccaccagggattggtgggcacaggaaattgctgaagtc
tatgagaacccccggaattcctccctcagcatcaaattcgatggactctggatcgacatg
aatgagccctcaagctttgtccatggcaccattggcggctgccgggatcggaacctcaac
ttcccaccctacatgccccaattgggatcccgatctgagggcctgagcttcaaaaccatc
tgcatggaggggcagcagcagctgccagacgggtcccccgtacgccactatgacgtccac
aacctctacgggtgggcgcagaccaaacccaccttggacatcctgcggaacctcacaggg
gagcgtgggatagtcgtcacacgctcaaccttccccagcagcgggaggtgggcggggcac
tggctgggggacaacacagctgcctggaaccagctggacaaatccatcattggaatgatg
gaattcagcctctttgggatctcttatagtggggctgatatttgtggatttttcggggag
ccctcatacgaactctgcgcccgctggatggagctcggtgccttctatccctattcccgc
aaccacaatgggaacaaggccaagcgacaggaccccgtggcctggaattccactttcgcg
gatctgtcccgggccgtgctccagctccggtaccggctcctgccccacctttacacactg
atgctccacgcccacgtccgtggcagcactgtggtgcggcccctcctgcatgagtttgtg
gaggacagaactacgtgggacatttacaggcagttcatgtggggggcgggtctgctcatc
agccctgtcctagagccgggtgtgtccgaggtgcgcgcatatctgcctgatgcccgctgg
ttcaatttccacactgacgaggaggttgtattccgtcgccagttccagaactttccagca
cccctgggccacatcaacctccatgtgcggggaggccacatcctcccccagcagctcccg
gccaacaacacttggttcagccgccagaacccgctgctcctgactgttgctctggacgac
gcccaggaggcctcagggaacctctactgggatgatggcgtgggcatcgacacttttgag
aagggcgagtacctgatgatgtcgttcaccgccagctctaacattctggagctgcgggtg
ctgcatggggggtacatggacccaaattccctgaaattcacagaaatcaaggtgctgggg
gtccctgggagcatacaggaggtgacagtgacacgcgatgggcttgatgtcccgtcccct
catgccgtggcccatgacccccaaaaacaggtgctgaaaatcacccaactggagctggag
ctgggtcagaactacaccctgaaatgggcctaa

DBGET integrated database retrieval system