KEGG   Parus major (Great Tit): 107199132
Entry
107199132         CDS       T04864                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04080  Neuroactive ligand-receptor interaction
pmaj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107199132 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107199132 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pmaj04030]
    107199132 (LPAR2)
G protein-coupled receptors [BR:pmaj04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107199132 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Glycophorin_A 7tm_4 Rax2 Ost5
Other DBs
NCBI-GeneID: 107199132
NCBI-ProteinID: XP_015471954
LinkDB
Position
Unknown
AA seq 251 aa
MKHCFYNETLGFFYNNSRKELSPHWRPKDILVVALGLAVSAVVLLTNLLVIAAVATNRRF
HYPIYYLLANLAAADLFAGVAYMFLMFHTGPRTAQLSLKTWFIRQSLLDTSLTASVVNLL
AIAVERHRTVLTMQLHSEMSAQRVVGLIFSIWAAALLLGLIPSYGWHCLCSLESCSRMAP
LYSRSYLTFWAVSNLAVFLVMVVVYGHIFVYVRRRMARMARHTGAHPRHRDTVMALVKTV
TIVLGGWLIRG
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaagcactgcttctacaacgagaccctcggcttcttctacaacaacagccgcaaggag
ctcagcccccactggcgccccaaggacatcctggtggtggccctgggcctggcggtcagc
gccgtggtcctgctgaccaacctgctggtcatcgccgccgtggccaccaaccgccgcttc
cactaccccatctactacctgctggccaacctggccgccgccgacctcttcgccggcgtg
gcctacatgttcctcatgttccacaccgggcccagaaccgcccagctgtccctcaagact
tggttcatccggcagagcctgctggacaccagcctgacggcctcggtggtcaacctgttg
gccatcgcggtggagcggcaccggacggtgttgaccatgcagctccacagcgagatgtcg
gcgcagcgcgtggtggggttgatcttctccatctgggcggcggcgttgttgttggggttg
atcccgtcctacggttggcactgcctgtgttccttggagagttgttccaggatggcgccg
ctctacagccggagctacctgaccttctgggccgtgtccaacctggccgtgttcctggtg
atggtggtggtctacgggcacatcttcgtctacgtgcgcaggaggatggcgcgcatggcg
cggcacacgggcgcgcacccgcggcaccgcgacaccgtcatggcgctggtcaagaccgtc
accatcgtgctgggtgggtggttaattaggggttaa

DBGET integrated database retrieval system