KEGG   Parus major (Great Tit): 107199815Help
Entry
107199815         CDS       T04864                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04310  Wnt signaling pathway
pmaj04510  Focal adhesion
pmaj04520  Adherens junction
pmaj04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107199815 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107199815 (CTNNB1)
   04520 Adherens junction
    107199815 (CTNNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107199815 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 107199815
NCBI-ProteinID: XP_015472883
LinkDB All DBs
Position
2
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcaagctgacttgatggagctggatatggcaatggagccagacagaaaagca
gcagtcagtcattggcagcagcaatcatatctggactctggtatccattctggtgccaca
acaactgctccctccttgagtggcaagggaaatcctgaagaagaagatgtggacacaaca
caagtgctgtatgagtgggagcagggattctctcagtccttcacccaggagcaagttgca
gatattgatggccagtatgcaatgactagagctcagagggtgcgtgcagctatgttccct
gaaacgctggatgaaggaatgcaaatcccatccacacagtttgatgcagctcatccaact
aatgtgcaacgcctggctgagccatcccagatgttaaaacatgctgttgttaatttgata
aactaccaagatgatgctgaacttgcaactcgtgcaatcccagaactgaccaaactgctg
aatgatgaggaccaggtggtggtgaacaaggctgcagttatggttcatcagctgtccaaa
aaggaagcatctcgccacgccattatgagatctcctcagatggtgtctgccatcgtacgt
accatgcaaaacacaaacgacgtggagacagcccggtgtactgcagggacactacacaac
ctctcacatcaccgtgaaggcttgttggccatcttcaaatcaggaggcattcctgctttg
gttaaaatgctggggtccccagtggactctgtgctgttctatgccataacaactcttcac
aatctcctgttacatcaggaaggagccaagatggctgtccgtctcgctggtgggctgcag
aaaatggtggccttgctcaacaagacaaatgtcaaattcttggccatcacaacagactgc
cttcagattttagcatatggcaatcaagaaagtaagctgattattctggcaagtggcggg
ccccaggctttagtaaacataatgaggacctatacttatgagaaactattgtggaccaca
agtagggtgctgaaggtgttgtcagtctgctccagcaacaaacctgctattgttgaggct
ggtgggatgcaagctttggggctccacctcacagatccaagccagcgtcttgtccagaac
tgtctctggactctgagaaatctgtcagatgctgcaacaaagcaggagggcatggaaggc
cttctaggaactctagttcagcttttaggatcagatgatattaatgttgtgacttgtgct
gctggcatcctttctaaccttacctgcaacaattacaagaacaagatgatggtatgccag
gttggtggcatcgaggctcttgtgcgcacagttctccgggctggagacagggaagacatc
acagaacctgcgatttgtgcgctccgtcacctcaccagcagacaccaagaagcagagatg
gctcaaaacgcagttcgtctccattacggactcccagtggtggtaaagctgttgcaccca
ccctcacattggcctttgatcaaggctactgttggcttgatccgcaacctggctctgtgt
cctgcaaaccacgccccgctgcgtgaacaaggtgctattccaagactagtgcagttgctg
gttagagcacaccaggatacccagcgacgcacttccatgggcgggacacaacagcagttc
gtggagggtgtgcgtatggaagaaattgtcgagggctgcactggagccctgcacattctt
gcacgtgatgttcataatcgaatcgtaatcaggggtctaaataccattccactatttgtg
cagttgttgtactctcccatcgagaatatccagagagtagctgctggcgtactttgtgaa
ctggctcaagacaaggaggcagctgaagcaattgaagctgaaggtgcaactgctccttta
acagaattgcttcattctaggaatgagggtgttgcaacctacgcagctgcagtgctgttc
agaatgtctgaggacaaaccacaggactataagaagcgactttcggttgaattgacaagc
tccctgttccggaccgagccaatggcttggaacgagacagcggatctcggactggatatc
ggtgcccagggagagcctcttggataccgcccagatgatcctagctaccgttctttccac
tctggcggatacggtcaggatgccttgggtatggaccctatgatggaacatgaaatgggt
ggccaccaccctggtgctgactacccagttgatggtctgccagatcttggccatgcccag
gaccttatggatgggctgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system