KEGG   Parus major (Great Tit): 107200057Help
Entry
107200057         CDS       T04864                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00010  Glycolysis / Gluconeogenesis
pmaj00030  Pentose phosphate pathway
pmaj00051  Fructose and mannose metabolism
pmaj00052  Galactose metabolism
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
pmaj01230  Biosynthesis of amino acids
pmaj03018  RNA degradation
Module
pmaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107200057 (PFKP)
   00030 Pentose phosphate pathway
    107200057 (PFKP)
   00051 Fructose and mannose metabolism
    107200057 (PFKP)
   00052 Galactose metabolism
    107200057 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107200057 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:pmaj01009]
    107200057 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:pmaj03019]
    107200057 (PFKP)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107200057 (PFKP)
Protein phosphatases and associated proteins [BR:pmaj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107200057 (PFKP)
Messenger RNA biogenesis [BR:pmaj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107200057 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107200057
NCBI-ProteinID: XP_015473490
LinkDB All DBs
Position
2
AA seq 785 aa AA seqDB search
MDHQPKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAFNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFLEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGMTEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEGGKVFANTDDSVCLLGMRRRN
LVFQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEA
ETGAI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggtgccgggaaggccatcgcggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgacaatattgtagaggtttcatgggaaagtgtttcaagtatcctgcaagtgggc
ggcacagtgatcggcagcgcgcgctgcaaatccttccgcacgcgcgagggccggctgcag
gccgccttcaacctggtgcagagagggatcaccaacctctgcgtgatcggcggtgacggc
agcctgaccggcgccaacctcttcagggaggagtggagcgggctgctggaagagctggca
cagaaaggaaagattgatgcagaggctgttaagaaatatgcttaccttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgaccataggtactgactca
gctctgcacaggataattgaagttgtggatgccatcatgaccactgctcagagccatcag
aggacatttgttctggaggttatggggcgacactgtgggtatctagctctggttagtgcc
ttagcctgtggtgcagactgggtgtttattcctgaatacccaccagaggaaggctgggaa
gattcaatgtgtgttaagctttcagagaaccgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgtcacaacaagcctataacatcagagaaggttaag
gatcttgtggttcagcggcttggttttgacacccgagtaaccatcctgggtcatgtgcaa
agaggtggaaccccttcagcttttgacagaattcttgcaagtcgtatgggtgtggaagcc
gtgcttgcccttttagaagctactccagatacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagaagttcagaaa
gccatggatgagggaaggttccttgaggctgtgaggcttcgtggaaggagctttgaaaac
aatcttaacacgtacaaattactgtcgcacaaaaagccagatgccgagctcccaaagact
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgccgcagtg
agggctgcagtgagagttggaatgactgaaggtcacaaaatatttgctgtcattgatggt
ttcgaagggttcgctagagggaagataaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatacttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagctgcccgggagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaataatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgcatcaagcagtcg
gccagcggcaccaaacgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggccctggcagcaggagctgatgctgcctacatcttcgaagagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctaagaaatgagaactgcaatgagaactacacaactgatttc
atttatcagctgtattctgaagaaggaaaaggagtttttgactgtcgaaaaaatgtattg
ggccatatgcagcagggtggagcaccttcaccatttgatagaaatttcgggacaaaaatt
tcagcaaaagctatgcagtggatctccaaaaaactgaaagaaacctaccggaaagaagga
ggaaaagtatttgccaataccgatgactcagtttgtttgctgggaatgcggagacgcaac
cttgttttccaacctgtggctgagctcaagagtgaaacagactttgtacacaggattccc
aaggagcagtggtggctgaagctgcgacccctgatgaagatcctggccaagtacaagacc
agctatgatgtgtcagactcaggccagctggaacacgtggccatgctcccaaaggaagct
gagaccggagccatctaa

DBGET integrated database retrieval system