KEGG   Parus major (Great Tit): 107200306Help
Entry
107200306         CDS       T04864                                 

Gene name
CNDP1
Definition
(RefSeq) beta-Ala-His dipeptidase isoform X1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00330  Arginine and proline metabolism
pmaj00340  Histidine metabolism
pmaj00410  beta-Alanine metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107200306 (CNDP1)
   00340 Histidine metabolism
    107200306 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107200306 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmaj01002]
    107200306 (CNDP1)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     107200306 (CNDP1)
Peptidases [BR:pmaj01002]
 Metallo Peptidases
  Family M20
   107200306 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 107200306
NCBI-ProteinID: XP_015474107
LinkDB All DBs
Position
2
AA seq 493 aa AA seqDB search
MSSSSSSLLEMEIFQYIDAHQSDFIKDLKEWVAVESDSVQPHLRKEVMRMMALAADRLAA
LGATVNLVNLGSHQLPDGQVLPLPSVILGELGKDPQNPTVCFYGHVDVQPAKKEDGWNTD
PYTLTEIDGNLYGRGATDNKGPVLAWINAVETFRALKFVMPVNFKFVIEGMEEAGSLGLE
KLLEEENQRFFSDVDYIVISDNLWLSNKKPALTYGCRGNACFFVEVECGSKDLHSGTFGG
IIHEPLLDLIALLDSLVDSTGHIQIPGIYNSVAALTEEERKLYESIEFDLEEHRKNCGVK
KFLYGTKEEILLHLWRYPSLSIHGIEGAFHEQGIKTVIPAKVIGKFSIRQVPHMDLSVVK
KQVVKHLEGVFSKRNSPNKLKVSMPLGAKPWLADVNDLLYKAARRAIKTVFGEDPDFIRD
GSTIPVARMFQTVTQKSVMMLPIGAADDGEHSQNEKISRHNYIEGTKLFAAFFLEISKLH
RNLHETSHTEAIN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctcatcatcttcattgctggaaatggagatcttccagtatattgatgcacat
caaagtgattttatcaaggatctgaaggaatgggtggctgtggaaagtgattctgttcag
ccacatctgagaaaagaagtaatgcgaatgatggcactggcagcagacagacttgcagca
ctgggagccactgttaatttagtgaacttggggtcacatcagctgcctgatggccaagtc
ctcccactgccttctgtgattcttggggagctggggaaggatccacaaaaccccactgtg
tgtttctatggtcatgtggatgtgcagcctgccaagaaggaagatggatggaacactgac
ccctacacactgactgaaatagatggaaacctctatgggcgtggagcaacagacaataag
ggacctgtcctagcttggataaatgcagtggaaacatttagagccttgaaatttgttatg
ccagtgaacttcaagtttgtaattgaaggcatggaagaagcaggatccttggggctagag
aagctacttgaggaagaaaaccagaggttcttctctgatgttgattatattgtaatttca
gacaacctgtggctcagcaacaaaaagcctgcccttacctatggctgtcggggaaacgcc
tgcttctttgtggaggttgaatgtggcagcaaggaccttcactctggaacttttggaggc
atcattcacgagccgctgctggacctgatagctctgctggacagcctcgtggattccaca
ggtcatattcagatccctggaatctataacagtgttgctgccctgacggaggaagaaagg
aaattatatgaatcgattgaatttgatctagaggaacatagaaaaaactgtggtgtgaaa
aaattcctttatggcaccaaggaagaaatacttctacacctgtggcgttacccctctctc
tctattcacgggattgaaggagctttccatgaacaaggcattaaaacagtcattccagca
aaagtaattggcaaattctcaatccgtcaggtcccccacatggacctttcagttgtgaaa
aaacaggtggtgaaacacttggagggtgtcttttccaagaggaacagtccaaacaaactg
aaagtgtccatgcctttgggtgcaaagccctggcttgcagatgttaatgatctgctatat
aaagcagcaagacgggcaataaaaacagtttttggagaagatccagatttcattcgtgat
ggctcaacgattcctgttgccagaatgtttcagactgtaacacagaaaagtgtgatgatg
cttcccattggagcagctgatgatggggaacattcccagaatgagaaaataagcagacac
aactatattgaaggaaccaaattgtttgcagcatttttcctggagatatcaaagctacat
cggaacttacatgaaacttcccacacagaggctatcaactga

DBGET integrated database retrieval system