KEGG   Parus major (Great Tit): 107200805Help
Entry
107200805         CDS       T04864                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00020  Citrate cycle (TCA cycle)
pmaj00190  Oxidative phosphorylation
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107200805 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107200805 (SDHA)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107200805 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107200805
NCBI-ProteinID: XP_015475247
LinkDB All DBs
Position
2
AA seq 665 aa AA seqDB search
MAAAAARGLAKRWLRPAAASRAWPAACQAPARNLHFTVYGKKNASTKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQ
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIANTCKPGE
PIPPIKPNAGEESVANLDKLRFADGSIRTSEVRLSMQKAMQNHAAVFRTGSVLQEGCEKL
SQIYGDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKL
RVDEFDYSKPLQGQQKKPFEEHWRKHTLSYVDIPTGKVTLKYRPVIDKTLNEEDCQTVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggctgcgcgggggctggccaagcgctggctgcgaccggccgcggcttcc
cgggcgtggccagcagcatgccaggctcctgcacggaacttacacttcacagtctatgga
aagaaaaatgcctccacgaaggtgtctgactcgatttctacacaatacccagtagtggac
catgaattcgatgcagttgttgtgggtgcaggaggagcaggtctgcgggctgcctttggt
ttgtcagaagctgggtttaacacagcctgtgttaccaagctgttccccacccgctctcat
acagttgctgcacagggagggatcaatgctgctctggggaacatggaggatgataattgg
aggtggcatttctatgacacagtgaaaggatcggactggctgggtgaccaggatgccata
cactacatgactgagcaagccccagctgcggtgatagagctggaaaattatgggatgcca
ttcagcagaactgaagaaggaaaaatctatcagcgtgcatttggtggacagagtcttcag
tttggaaaaggaggacaggcccacagatgctgttgtgttgcagacaggactggacattca
ctcttacatactttgtatggcaggtctctacgatatgatacaagctactttgttgaatat
tttgccttggacctacttatggagaatggagaatgccgtggagttattgccctctgcatt
gaagatggaaccatacatcgttttagagcaaagaacacggtcattgccactggtgggtat
ggccgcacttacttcagctgcacatctgctcataccagtactggtgatggcacggccatg
gtcacacgagctgggctcccttgccaggacttagaatttgtgcagtttcaccctacaggt
atctatggggctggctgccttatcacagaaggatgtcgtggagagggaggtattctgatc
aacagccaaggtgaaagattcatggagagatatgcacctgttgccaaggatctggcttcc
agggatgtagtgtctcgttctatgaccatagaaatccgtgaaggaaggggttgtggtcct
gaaaaagatcatgtgtacttgcagttgcaccacttgccaccacagcagctggcaacccgt
ctcccagggatctccgaaacagccatgatattcgctggagttgatgtcactaaagaacct
atccctgtcctgcctactgtgcattacaatatgggaggtattcctactaactacaaagga
caggtgatcacacatgtcaatggtgaggataaggtggtgcctgggttatacgcctgcggg
gaagcggcctctgcatctgtccatggtgcaaatcgacttggagcaaactctcttctggat
ttggtggtctttggtcgtgcttgtgctctgactattgcaaatacatgcaagcctggagag
ccaattcccccaattaaaccaaatgctggtgaagagtcagttgctaatcttgacaagtta
aggtttgctgacggaagcataaggacttcagaagtgcgacttagcatgcagaaggcaatg
caaaaccatgctgctgtatttcgtactggttctgtactccaagaaggctgtgagaaactt
agccaaatttatggtgatctggctcatctaaagacttttgacagaggtattgtgtggaac
actgacttggtggagacccttgaactgcagaacctgatgctttgtgctctacaaaccatt
tatggtgctgaggctcgcaaagagtcccggggtgcccatgccagagaggattataagtta
cgggtagatgagtttgactactctaagccactccaaggccaacagaagaagccatttgag
gagcactggagaaagcacaccctgtcatatgtggatatcccaactgggaaggttaccttg
aagtacagaccagtgattgacaaaaccttgaatgaggaagattgccagactgtcccaccg
gcgatccgctcatactag

DBGET integrated database retrieval system