KEGG   Parus major (Great Tit): 107203533
Entry
107203533         CDS       T04864                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04020  Calcium signaling pathway
pmaj04144  Endocytosis
pmaj04510  Focal adhesion
pmaj04540  Gap junction
pmaj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107203533 (PDGFRA)
   04020 Calcium signaling pathway
    107203533 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107203533 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107203533 (PDGFRA)
   04540 Gap junction
    107203533 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107203533 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107203533 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pmaj04090]
    107203533 (PDGFRA)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107203533 (PDGFRA)
Protein kinases [BR:pmaj01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107203533 (PDGFRA)
CD molecules [BR:pmaj04090]
 Proteins
  107203533 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 107203533
NCBI-ProteinID: XP_015481249
LinkDB
Position
4
AA seq 1087 aa
MGTSPQTFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGNHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPAVIPCRTSDPDAQVTLVNSLDKPVYALYDTKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNMSDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccacagaccttcttgatcctgggatgttttctcacaggaccattccta
acattttgccagcttcctctgccaaccattgttcccaataggaatgaaatggtggtacag
ctgaattccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgaccgagggaaaccacaggatagacattagacacgaagaaaacaacagtggcctcttc
gtgacagtgctcgaagtaggaaatgcctcggccgcccatacaggcttgtatgtttgctat
tataaccacacacaagtggaggacggggaagtggaagggaaggacatctacatctacgtg
cctgacccagatatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcctgcagttattccttgtcggacaagtgacccagatgctcaagtgacttta
gttaacagtttagacaagcccgtgtatgctttatatgacaccaaacaaggcttcataggc
aattttcctgcgggctcatacacatgcaaaacaatggttaaaggcgtggagttcaaatct
gacgagttcctcatctatattataagagctacttcacagctgcctgttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaaggctttgttcacctggagccccag
tttagccctctggaagctgtcaacctgcatgaagtcaaaaactttgttgttgatgtgcag
gcttacccagcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
acggagattgttactagttccaacagagtccaggaaacaaggtttcagagtattttaaaa
ttgatacgggccaaggaggaagacagtggatactatactttggttgctgaaaatgaagat
gaaattaaaagatacaccttctcattgctaatacaagttccagctctgatctcagctctt
gtggatgatcaccatggctctgcaggtgggcagacagtgagatgtttggcagaggggacc
ccacttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcatggacccttttgactaacaatatgtctgatatacacatggaagcccacctggatgag
aaaaatatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgacctcggtgctgttactcgagaactgaagcttgtggctcccacc
ttgagatcagagctgacagtggctgctgccgtcttagtgctgttagtgattgtgataatt
tcactgattgtcctggtcatcatatggaaacagaagccaaggtatgagattagatggaga
gtcattgagtctatcagccctgatggccacgagtacatttatgtggacccaatgcaactg
ccttatgactccagatgggaatttcctcgagatgggttagtgcttggtcggatccttggt
tctggtgcatttggaaaagtagttgaagggactgcatatggattgagtcgctctcaaccg
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcattactgaatactgtttttatggg
gatttggtgaactacctgcataagaatagggacaatttcctgaaccgacacccagaaaag
cctaaaaaagatttggatatctttgggatgaaccctgctgatgaaagcacaagaagttat
gtgatactatcgtttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggctctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcatataagaagaaatccatgtcagaatcagaagtcaaaaac
cttctttcagatgacagttcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggct
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagtacttttctcccagtaaaa
tggatggcacctgaaagtatttttgacaacctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtggattctactttctacaataagatcaagagtggataccgaatggccaaacccgatcat
gctaccaatgaagtgtatgagattatggtgaagtgctggaacagtgaaccagagaaaaga
ccgtctttctaccatttgagtgaaattgtggagagcctgctgcctggagagtacaaaaag
agctatgagaagattcatctggacttcctgaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtaacttacaagaacgaagacaagctaaag
gacagggagagtggatttgatgagcagaggctgagtgctgacagtggatacatcattccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaagaaacagacacagttcg
cagacatctgaagaaagtgccattgaaactggttccagtagctctaccttcatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system