KEGG   Parus major (Great Tit): 107203764Help
Entry
107203764         CDS       T04864                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8 isoform X1
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
pmaj  Parus major (Great Tit)
Brite
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107203764 (HDAC8)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     107203764 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 107203764
NCBI-ProteinID: XP_015481623
LinkDB All DBs
Position
4A
AA seq 372 aa AA seqDB search
MAAVPPPVYVYSPEYVTLCDSLCKVPKRASMVHSLIEAYCLLDQMKIVKPKVASMEEMAS
FHTDAYLQHLQKVSEEGDDDHPESVEYGLGYDCPATEGIFEYAAAVGGATITAAQCLLDG
KCKVAINWPGGWHHAKKDEASGFCYLNDAVLGILRLRQKFDRVLYIDLDLHHGDGVEDAF
SFTSKVMTVSLHKFSPGFFPGTGDVTDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLK
EVYAAFNPNAVVVQLGADTIAGDPMCSFNMTPEGVGKCLKYVLQWQLPTLVLGGGGYNLA
NTARCWTYLTGVILGRTLSSEIPDHEFFTEYGPDYVLEITPSCRPDRNEPQRIQEILNSI
KAPGVVLTSLAW
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgccgccgccggtctacgtatacagcccggagtacgtgaccctctgcgac
tccctctgcaaagtgcccaagcgggccagcatggtgcattcactgattgaagcgtattgc
ttacttgaccagatgaagatagtcaagccaaaagtggcctccatggaggaaatggcgagt
ttccacacagatgcttacctgcagcacctgcagaaggtcagtgaggagggcgatgatgac
cacccggagtctgtggaatatggactgggttacgactgtccagccactgaagggatcttt
gagtatgcagcagctgtgggaggagccaccatcactgcagcccagtgcctgctggatggc
aagtgcaaggtagcaattaactggcctggagggtggcatcatgcaaagaaggatgaagct
tctggtttctgttacctgaatgatgctgtcttgggtatcctgcggctgcgccagaagttt
gaccgtgtcctttatatcgatttggatttacatcatggggatggagttgaggatgccttt
agtttcacttcgaaagtcatgactgtttctctgcacaaattttcaccaggatttttccca
ggcactggtgatgtgacagatgttggcctgggaaaaggtcgctattacagcgtgaatgtg
cccattcaagatggcattcaggatgaaaagtattaccagatctgtgaatcagtgctgaag
gaggtgtatgctgccttcaaccccaatgcagttgtggtgcagctgggggcagacaccatt
gctggagaccccatgtgctctttcaacatgacacccgagggagtgggcaagtgcctcaag
tatgtcttgcagtggcagctaccaactcttgtcctgggaggaggaggttacaaccttgcc
aacacggctcgctgctggacatacttgaccggggtcatccttgggagaacactctcctct
gagatccctgatcatgagttcttcacagagtatggtcctgattacgtgctggagatcaca
ccaagctgcagaccagaccgcaatgagccacagagaattcaagaaattctgaactctatc
aaagcacctggtgtggtgttaaccagtcttgcatggtga

DBGET integrated database retrieval system