KEGG   Parus major (Great Tit): 107204220
Entry
107204220         CDS       T04864                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04012  ErbB signaling pathway
pmaj04068  FoxO signaling pathway
pmaj04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107204220 (CDKN1B)
   04068 FoxO signaling pathway
    107204220 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107204220 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107204220
NCBI-ProteinID: XP_015482545
LinkDB
Position
1A
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRELKKHLQEMEEAYQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCIAQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ANSVEQTPKKSSPGRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggaacgcatggaggccagacag
tcggagtacccgaagccgtctgcgtgcaggaacctcttcgggccggtgaaccacgaagag
ctcaacagggagttgaagaaacacctgcaggagatggaggaggcgtaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcagatacgagtggcaagctgtggaa
aaagggagctcgcccgacttctactttagaccccccaggctacggaaagccgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcaatgcattgcccagaggaaaagacccgcggccgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccaattcagtggagcaaacacccaagaaatcaagcccaggaagacatcaaacgtaa

DBGET integrated database retrieval system