KEGG   Parus major (Great Tit): 107204345Help
Entry
107204345         CDS       T04864                                 

Gene name
MAGI2
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 isoform X1
  KO
K05629  atrophin-1 interacting protein 1
Organism
pmaj  Parus major (Great Tit)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 MAGI_u1 PDZ_2 WW Guanylate_kin MAGI_u5
Motif
Other DBs
NCBI-GeneID: 107204345
NCBI-ProteinID: XP_015482789
LinkDB All DBs
Position
1A
AA seq 1538 aa AA seqDB search
MSKGLKKKSHWTSRVHEIVIVRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYEGGSKL
VPEELLLEVNETPVAGLTIRDVLAVIKHCKDPIRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPGAEGKRKRNKSVSNMEKTGIEPPEEEEEERP
VVNGNDVTVTPESSEHEEKSTAVLGEASTTQPSPAPGYGQPEEAKEDMDVTKQTKPEEND
DLGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDD
PIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPNAELGTKPMQAQGFREKPLFTRDASQ
LKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEV
CVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAVMERPPVVVNG
RHNYETYLEYISRTSQSVPDVTDRPPHSLHSIPADSQLDSTFPPPAHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHA
EVVDILKECPVGSETSLIIHRGGFFSPWKTPKPMMERWENQGSPQTSVSAPAMPQNIPYP
PTLHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVLPRTGFRVDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHNAARNGQVNLTVRRKVLPTESSSQKGAPAPGATPPRSSPSARKMANNQGEPCPE
NGRSPGSVSTHHSSPRSDYTTYANSNHAVSSSNATPPEGFASHSLQTSDVVIHRKENEGF
GFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADI
VKLIKDAGLSVTLRIIPQEELNSPASAPSSEKQSPMAQQHSPMAQQSPLAQQSPVAQHSP
VAQPPPPQPLQPQGHENSYRSEVKARQDVKPDIRQPPFTDYRQSSTDYRQPPLDYRHPPV
MDYQQPPPLDYRQPPLMDYRQHSPDTRQYPLAEYRQPQDFDYFTVDLEKGAKGFGFSIRG
GREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIKSGGRRVRL
LLKRGTGQVPEYDEPNSWSAPSATSPGLPEVALSLDDIISPLSSSHIAPPSDPSHQISPE
PTWDIKREHDVRKPKELSVNGHKKKRLGEQRERSASPKKVDRSKHEEASWKGYSEGKNKT
TDGGRPTSDSKVVGHSVMIEAGAREHMCAGTSDEQFGRLRKPESKRGGSLSKKEDHRSTN
TSEKKSAAAPDHVKMDTGATKTYSSNRCGSPGSDMDHSQRDPDGKPSEFPRKGHLHSIST
RSTNTAVRKATVSPGPWKIPGSDKLPSVLKSGTSAMSR
NT seq 4617 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggcttgaagaagaaaagccactggacgagcagagtccacgagatcgtgatc
gtgaggaacccggagggacagctgggcttcgagctgaaggggggcgccgagaatgggcag
ttcccctacctgggggaagtgaagcccggcaaggtggcctatgagggcggcagcaagttg
gtgccggaggaactgctgctggaggtgaacgagacccccgtggccgggctcaccatcagg
gatgtgctggccgtgatcaagcactgcaaggaccccatccgcctcaagtgcgtcaagcaa
ggaggcattgttgataaggaccttcgtcactacctcaatctccgattccagaaaggttct
gtggaccatgagctccagcagatcataagagacaatctctacctccgcacagtgccatgc
accacaaggccacataaggagggggaagtccctggtgtggactatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtggaacatatgaagac
aactattacggcactccaaagcctccagcagaaccggctccgttgctgttaaatgtgaca
gaccagatcctcccaggagccactcccggggctgaaggcaaacgtaaaaggaataagtct
gtgagcaatatggagaagacaggcattgaaccaccagaggaagaagaggaagaaagacct
gtggtcaatggaaatgacgtgacagtaacaccagaatcaagtgaacatgaagagaagagt
acagctgtcttgggtgaggcatctaccacccagccttctcctgcaccaggatatggtcaa
cctgaagaagcaaaggaggatatggatgtaacaaaacagactaaacctgaagagaatgat
gacttgggcccactgcctgataactgggaaatggcctatacagaaaagggagaggtctac
tttattgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggct
aaacctccagaagagtgcaaagaaaatgagcttccatatggctgggagaaaattgatgat
cccatttatggcacttattatgttgaccacataaatagaagaactcaatttgaaaaccct
gtcctagaagcaaaaaggaagctacagcagcataacatgcccaacgcagaacttggaaca
aagcctatgcaggcccaaggtttccgagaaaaaccactcttcacccgtgatgcatcacag
ctgaaggggactttcctcagcacaactcttaagaaaagcaacatgggttttggatttacc
atcattggtggggacgagccagatgagtttctccaggtgaagagtgtaattcctgatggg
cctgcagcacaagatgggaaaatggaaacaggtgatgtgattgtctatattaatgaagtt
tgtgtccttggacatactcacgcagatgtagtcaaactcttccagtctgttcctattggt
cagagtgtcaacttggtgctatgtcgtggataccctttgccctttgatcctgaagatcct
gccaacagcatggtgccaccccttgcagtaatggagaggcctccggtagtggtaaatgga
agacataactatgaaacttatttggaatacatttctaggacttctcagtctgttccagac
gtaacagatcgaccaccacactccttgcactccattccagcagatagtcagcttgatagc
acattcccaccacctgcccatgatgataatgtatcaatggcttcttctggggccacccaa
gctgaactcatgaccttaaccattgtgaaaggggcccagggctttggcttcactatagca
gacagtcctacaggacagagggtgaagcaaattctagacattcagggatgtcctggtttg
tgtgaaggtgacctcattgttgagatcaaccagcagaatgtacagaacctgagccatgca
gaagtagtggatatacttaaagaatgtcctgttggaagtgaaacttctttgattatccat
agaggaggtttcttttctccatggaaaactccaaagcctatgatggaacgatgggagaat
caaggcagccctcaaacaagtgtgtctgctccagctatgccacagaatattccctatcca
cccactcttcacaggagttcatttcctgattcaacagaggcctttgatccacgaaaacct
gacccatatgagctgtatgagaaatcaagagccatttatgaaagtaggcaacaagtgctg
cccaggactggttttcgagtggattcctctggtccagattacaaggagctggatgttcac
cttcggagaatggagtctgggtttggcttcaggatcctgggaggagatgagcctgggcag
cctattctcatcggagcagtaattgccatgggctcagcagaccgagatggtcgtctccat
cctggtgatgagctggtgtatgtagatgggattccagtggccggcaaaacccaccgatat
gtgattgatcttatgcataatgctgcccgaaatgggcaggtgaatcttactgtgaggaga
aaggtgctacccacggagtcctccagccagaaaggtgccccagcgcctggtgcgacgccc
cctcgcagctctcccagcgcgaggaaaatggccaataaccaaggagagccctgcccagag
aatggcagaagcccaggctcagtgtctacgcaccacagctctccaagaagtgactacacg
acttacgccaacagcaatcacgctgtctccagcagcaatgctacaccccccgagggcttc
gcgtctcacagcctgcaaaccagcgacgtggtgatccaccgcaaggagaacgaaggcttt
ggctttgttatcatcagctccctgaacaggcccgaatctgggtccacaataactgtaccc
cataaaatagggcggataattgatggaagtcctgcggatcgctgtgcaaaacttaaagtt
ggagaccggatcttagctgtgaatggccagtctattattaacatgcctcatgcagatatt
gtgaagctaattaaagatgcaggtctcagtgtaactcttcgcatcattcctcaggaggag
ctgaacagcccagcctcggcgcccagctcggagaagcagagccccatggcccagcagcac
agccccatggcccagcagagtcccctggcacagcagagccccgtcgcccagcacagcccc
gtggcccagcctccacctccacagcccctccagccacagggacacgagaacagttacagg
tcagaagtaaaagccaggcaggatgtgaagcctgatatccggcaacccccgtttacagac
tacaggcaatcctccacggactaccggcagcccccgctggactaccggcaccccccggtg
atggattaccagcagcccccaccgctggactacaggcagccccccctgatggactacagg
cagcactcccccgacaccaggcagtaccccctggccgagtacaggcagccccaggacttt
gattatttcaccgttgatttggagaaaggagccaaagggtttgggtttagtattcgagga
ggaagggagtacaaaatggatttgtatgtgttgaggttagcagaagatggaccagcaata
agaaacggaaggatgagggtaggagatcaaataattgaaatcaatggagaaagcacaagg
gacatgacacatgccagagcaatagagctaatcaagtctggtggcaggagagtgcgactg
ttgttgaaacgtgggacaggccaggtcccagaatatgacgaaccaaactcctggagtgct
ccctctgccacctccccaggtctgccggaagtagctctttccctcgatgacataatctca
ccattatcttcatcacacatagccccaccctctgacccttctcaccagataagcccagag
ccaacatgggatatcaagagggaacacgatgtaaggaaaccaaaggagctttcggtgaac
ggtcacaaaaagaaaaggttaggagaacaaagagaaaggtcagcaagtcctaaaaaggta
gacaggtcaaagcacgaagaggcttcttggaaaggatattcagaaggcaaaaataagacc
actgatggtggcaggcccacctcagacagcaaagtggtgggacacagcgttatgatcgag
gctggcgcaagagagcacatgtgtgctggaaccagtgatgaacagtttgggaggctgagg
aagccagaaagcaagagaggaggatctcttagcaaaaaagaagatcacagatccacaaac
accagtgagaagaagtcagctgcagcacctgaccatgtcaagatggatacaggagctacc
aagacatacagtagcaaccgctgcggctcacctggaagtgatatggaccacagccagagg
gaccctgatgggaaacccagcgagttccccaggaagggacatctccactccattagcact
cgcagcaccaacaccgcagttcgaaaggcaacggtctctccagggccgtggaaaatccct
ggctcagacaagctaccaagcgtcctgaagtctggtacttctgccatgagcagataa

DBGET integrated database retrieval system