KEGG   Parus major (Great Tit): 107204397
Entry
107204397         CDS       T04864                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04020  Calcium signaling pathway
pmaj04260  Cardiac muscle contraction
pmaj04261  Adrenergic signaling in cardiomyocytes
pmaj04270  Vascular smooth muscle contraction
pmaj04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107204397 (CACNA1C)
   04020 Calcium signaling pathway
    107204397 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107204397 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107204397 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107204397 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107204397 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmaj04040]
    107204397 (CACNA1C)
Ion channels [BR:pmaj04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107204397 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107204397
NCBI-ProteinID: XP_015482898
LinkDB
Position
1A
AA seq 2148 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNV
PGADMEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEMEKTAVEEETKEEKIELKSITADGESPPATKINVDDYQPNESEEKSPYPT
TEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVND
NIFTNLILFFILLSSISLAAEDPVRHLSFRNQILGNADYVFTSIFTLEIILKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDG
EVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFT
GLFTVEMVLKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEE
NSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGM
QVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPAN
STEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKR
IWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFN
ATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFY
ATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLT
AEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSGFPQTFTTQRPLHINKSG
NNHGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGH
GTPLSPTICVQEAPWKLPSKRTHYYEALGRSSSRDSQLAIVCQEEVSQDETHDENLNEDI
EYCSEPSLLSTEMLAYQDDENRQLTPPENSKGEDTRPSPKKGFLCSSALGRRASFHLECL
KRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCATPPATPCNRGW
PQQSIPTLRLDGAESSEKLNSSLPSVHCGSRYPEGGGSPRRARPVSLTVPSPSAGSSRQL
HGSASSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQS
PNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIYISSL
NT seq 6447 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccagaagaaaaccatcaaggttccaactat
gggagtccccgtccggctcacgccaacatgaacgccaacgcggcggcggggctggccccg
gagcacatccccacgccgggggcagccctgtcctggcaggctgccatcgatgctgccagg
caggccaagctgatgggcagtgctggcaacgccaccatttccacggccagctccacgcag
aggaagaggcagcagtacggcaagcagaagaagcagggcagcaccacggccacgcgcccg
ccgcgcgcgctgctgtgcctgacgctgaagaatcccatccggagagcgtgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tacggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcgataggaggaaaaggtgccggatttgatgttaaagcactgcgggctttccga
gtattacgtccactacggctggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcatattgccctgctggtgctgtttgtcattatt
atctatgccatcattggactggagttattcatggggaagatgcataagacctgctaccat
gtgcaagggggactgatagatacacctgcggaggacgacccgtctccgtgtgccccccag
tctgcccacgggcggcagtgtcagaacggcaccgagtgcaaggcgggctgggagggacct
aagcacggcatcaccaactttgacaattttgcttttgccatgctcacggtgtttcagtgc
atcaccatggagggctggaccgatgtgctgtactggatgcaggacgctatgggctatgag
ttaccatgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctg
gttcttggtgtgttgagcggggagttttccaaagaaagagaaaaggctaaagctcgaggg
gatttccagaagctacgggaaaagcaacagctagaggaggatctgaagggatacttagat
tggataactcaagcagaagatattgatccagaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacatgagcatgcccaccagcgagaccgagtccgtcaacaccgacaacgtc
cccggagcggacatggagggcgagaactgcggcgccaggctggcgcatcggatctcaaaa
tcaaaatttagtcgctactggcgccgatggaaccgattctgcagaaggaagtgccgtgct
gctgtcaagtccaatgttttctattggctggtgatcttcctcgtgtttctcaacaccctc
accattgcctctgagcactacaaccagccagactggctcacagaggtccaagacactgcc
aacaaggtgctgctagctcttttcacggcagagatgctgctgaagatgtacagcctcggt
ctccaggcctactttgtgtccctcttcaaccgctttgactgcttcatcgtgtgcgggggc
atcctggaaaccatcctggtggagacaaagatcatgtcacccctgggcatttcggttttg
agatgtgtcaggctcctaaggatatttaaaatcacaagatattggaactccctgagtaat
cttgtggcttcactcctgaattcagtccgctccattgcctccctgttgctgctcctcttc
ctcttcatcatcatcttctcactcctggggatgcagctctttgggggcaagtttaacttt
gatgagatgcagaccaggaggagtacatttgacaacttccctcagtccctcctgactgtg
tttcagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccaggaatgttggtctgtatttacttcatcatcctcttcatctgt
ggaaactatatcctgctgaatgtatttttggccattgctgtggacaaccttgctgatgct
gagagtttaacatctgcacagaaagaggaggaagaggagaaagaaaggaaaaagcttgct
aggactgctagtcccgaaaagaaacaggagatggaaaaaacagctgtggaggaagagaca
aaggaggagaaaattgagctgaaatcgatcactgctgatggagagtccccacctgctacc
aagatcaacgtggatgattatcagcccaatgaaagcgaagaaaagagcccttatcccacc
acagaagcaccagcagaggaagatgaggaagaacctgagatgcctgtcggccctcgacct
cgcccgatgtctgagctgcacctcaaggaaaaggctgtgcccatgcctgatgccagtgct
ttcttcatcttcagtcctaacaacaggttccgtgtccactgccatcgaatcgttaacgat
aacattttcaccaacctgatcctatttttcatcctgctcagcagcatctccctggcagct
gaggaccccgtgagacacctctcctttaggaaccaaatcctaggcaatgcagactatgtc
ttcactagtatctttacattagaaattattcttaagatgacggcctacggggctttcctc
cacaagggctccttctgcaggaactatttcaacatcttagacctgctggtggtcagcgtt
tctctcatctcctttgggatccagtccagtgcgattaatgtggtgaagatcctgcgtgtt
ctgagggtccttagaccactgagggccatcaacagagccaaaggactaaagcacgtggtc
cagtgtgtgtttgtcgccatcagaaccatcgggaacattgtgattgtcaccactttgctg
cagttcatgtttgcctgcattggagtccagctgttcaagggcaagctgtacagctgcact
gacagctccaagcagacagaagcagagtgcagagggtactacatcacctacaaggatggg
gaggtcagccagcccatgatacagccccgcagctgggagaacagcaagttcgacttcgac
aacgtcctgactgccatgatggccctcttcaccgtctccaccttcgagggctggccagag
ttgctgtataggtccattgattcccacatggaggatgtgggacccatctataatcacagg
gttgagatctccatcttctttattatctacatcatcatcattgctttcttcatgatgaac
atcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaacaagagtacaagaac
tgtgagctggacaaaaaccagcgccagtgtgtagagtatgccctgaaagcccggcccctg
cggagatacatccctaaaaaccagtaccagtacaaagtttggtacgtggtcaactccacc
tattttgaatacctgatgttcgttctgatcctgctgaacaccatctgcctggccatgcaa
cactatggtcagagctgcatgttcaaggaagccatgaatatcctcaacatgctcttcact
ggcctcttcaccgtggagatggtcctgaaattaatcgccttcaaacccaagcactatttc
tgtgatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagca
atcaccgaggtgaacccagctgaacatacccaatgctcttcctctatgaacgcagaggaa
aactctcgcatctcaatcaccttcttccgactcttccgcgtgatgcgcctggtgaagctc
ctgagccgaggggagggcatccggacgctgctctggaccttcatcaagtccttccaggct
ctcccctacgtggctcttttaatagtgatgctgttcttcatctacgctgtgattgggatg
caggtgttcggtaaaatcgcgctgaacgacaccacagaaatcaaccgcaacaataacttc
cagaccttcccccaggcagtgctgctgcttttcaggtgtgccacaggtgaggcctggcag
gaaatcatgctggcatgtctcccggacaagaagtgtgacccagagtcggagccggccaac
tccacggaagccgatcactcctgtggcagcagcttcgccgtcttctatttcatcagcttc
tacatgctctgtgccttcctgatcatcaatctttttgtagctgttataatggataacttc
gattacctgacacgggactggtccattttaggaccacaccacctggatgagtttaaaagg
atctgggcagagtatgaccctgaagctaagggacggatcaaacacttggatgtggtgacg
ctgctccggcggatccagcccccgctgggcttcgggaagctctgccctcaccgcgtggct
tgcaaacgccttgtctccatgaatatgccactgaacagcgatggcaccgtcatgttcaat
gccactctctttgcactggtcagaactgcactgaggatcaagacagaaggtaacctggag
caagccaacgaagagctgagagcaataattaagaaaatctggaagcgcaccagtatgaag
ctgctggaccaggtggtgcctcctgcaggtgatgacgaggtgaccgtggggaagttctac
gccactttcttgatccaggagtatttccggaagttcaagaagcgcaaggagcaggggctg
gtggggaagccctcgcagcgcaacgcgctgtccttacagtttgctgttttgcaggctggt
ctgcgcacactccacgacatcgggcccgagatccgacgagcaatttctggagacctgaca
gctgaagaggagctggacaaggccatgaaagaagctgtttctgctgcctctgaagatgat
atcttccggagagctggaggcttgtttggaaaccacgtgagctattaccaaagtgacggc
aggagcgggttcccccagactttcaccacccagagacctttgcacatcaataagtctggc
aacaaccacggagacaccgagtctccatctcacgagaagctggtggactccaccttcact
cccagcagctactcatcctcaggctccaatgccaacatcaacaatgccaacaacaccgcc
ctgtgtcgcttccccagcccacccagctaccccagcactgtcagcacggtggaaggccat
gggacccccttgtcacccaccatttgtgtgcaggaggctccctggaaactcccatccaaa
aggacacattactacgaggcactgggacgctccagttccagagacagccagctggcaatt
gtttgccaagaggaagtgtctcaggatgagactcatgatgaaaatttgaatgaagacatt
gagtactgtagtgaaccaagtctgctctctaccgaaatgcttgcataccaggatgatgaa
aacagacaactcactccgccagaaaacagcaaaggagaggacacccggccctctccgaag
aaggggtttctgtgctcctcagctctaggtcgaagagcatcttttcacttagagtgtttg
aaaagacagaagaaccagggcgtggatgtctcgcagaagacagtcctgcctttgcatctg
gtccatcaccaggcattagcagtggccggcctgagtcccctgctccagcgaagccattcc
cccaccatgttctctcggctgtgtgctacacccccggccacgccctgcaaccgaggctgg
ccgcaacagagcatcccaacgctgcgcctcgacggggcggaatcctcggagaagctcaac
agcagcttgccgtcggtgcactgcggctcccggtaccccgagggcggcggcagccccagg
agagcccggccggtgtccctgaccgtgcccagccccagcgcaggcagcagccggcagctc
cacggcagcgccagcagcctggtggaagcggtcttgatttcggaaggactgatgcagttt
gctcaagatccaaagttcattgaggtcacaacccaggagctcgcagacgcctgcgacatg
acgatagaagagatggaaaatgcagcagacaacattctcaatggtaacagcaagcagagc
cccaatggcaacctcttgccttttgctaactgcagggacccagggcaggacagtgcagga
gaggaagaggaagaggtgcagaacccggattgtaggataagtcaggaggagctcaaggac
agcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system