KEGG   Parus major (Great Tit): 107204411Help
Entry
107204411         CDS       T04864                                 

Gene name
TUBGCP6
Definition
(RefSeq) gamma-tubulin complex component 6
  KO
K16573  gamma-tubulin complex component 6
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmaj03036]
    107204411 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pmaj04812]
    107204411 (TUBGCP6)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     107204411 (TUBGCP6)
Cytoskeleton proteins [BR:pmaj04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     107204411 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl GCP_C_terminal GCP_N_terminal DUF4573
Motif
Other DBs
NCBI-GeneID: 107204411
NCBI-ProteinID: XP_018862174
LinkDB All DBs
Position
1A
AA seq 2459 aa AA seqDB search
MASGTALIYDEEMTTHKLLWSDPICDIEVPERLSSSYEQLRSYHLVERCVHVPAREGSEE
EILLVHSLEHLEVAKSTQTMNEEELKRVSENYDAFFFHPSTFHCARLAVGATLQLVDAVM
SGKVRNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWNKVGMGNSDY
LAAFFHVLLPMAFEFDPELVIVSSGYDSGIGDPEGQMNATPEVFSHLTHFLMQLANGKLC
VILEGGYHLKSLGESVCMTVKTLLGDPVPQITGEMAPCLSAVESIQNVRAAHKPYWKWLA
YEDTSFLQNLSTKSHLLKKTNSSPSTELESKITNSNNTVKVERFLELHMKNILFPVPPIK
TATAGSEGSEHFLPEHVQLVKEMDKSEVKALVSGFYADLVKEDETLLSLGSMFVILDKIL
KKEVCNGIAATPTAGLSAAVALRHSVHFGLQRVLCVFVGDMQMIPNTEDGRMLIINICEK
EQSEKSSCKHYISLNWKEDAEGNDFFSAVLGFILPVAYSYQPNLTVIAVGPNRSLGISGI
SLLVALLQGLAESRIFAVIEDTEISLMQSVAKALLGASTPPFGIYVPPTQEKVNKIKALR
DQFQQEWKMLQCSGLPSHEIRYPDCNCPNPTVSFEMESITQLFNDLCEAHLTGLPWKVHL
GRQKISKRRAKQNLKRVAYNALFMNLFQDEARKLQSNVSRLPVKNKILMLSFNLRVAGLG
AQADRLENLVEELEAAECLPFTEVNSVLDLLVQLAGTGPPQLVPQKKDYFLNNKYVGRNV
KYQGYDYYDVSVFEADIQSLITNEECQFNDTIQQTLQIMEAAPGTGLPAIGLFSQGCPAG
DKFEKETRVSLFGALVHSRTYDMDIKLDLPPVPDNADLSGLAIKVPQSIDQSEDEGFQSA
SNLTPDSQSEPSMTPDIDLWDAVLTYGPSKRRCWERIGYPPGKKEEPYLTEAGREAFDKF
YKLREGELQLFTNTVLQLPQLVLVKEPELVKDVLNVLIGVVSTTFSLNQSAQSFVIKEGV
YVSGTSPETMHNLLSEVAEYGTYYTRLSRFSLQPVLDSSYSKGLVFQAFTSGLRKYLQYY
RACVLSTPPTLSLLTISFLFRKLGRQLRYLAELCGIGTTALGISGGAGASFPTGVKLLSY
LYKEALNNCSNEHYPVLLSLLKTSCEPYTRFIYDWVYSGVFRDVYGEFMIQVNEDYLCFR
DKHYWTHGYVLISKEVEDCVPVFLKHIANDVYICGKTINLLKLCCPRHYICWSDIPVPRI
SVIFSLEELKEIERDCAVYVGRMERIARYSSISKEEKDLRMEIAKQELIVHARETASKVL
KAISDKQVSERMALDAKKREQFQKLKEQFAKDQERRLAIRQEEIDDDFSYARELREREKR
LKALEEELEKKARQELIDHYSKLSDDAARREQRTLWKIQRHKLETARLKFLLEDQKHIEE
MLEKLPDENYRRKLDIIPFKQCQLALDKNPVDKDPPSEVSFVKPLQSNETVARIESEPEQ
GYAAAAAADKALPMPEPENNNADEHFQPKAIGSESSLQNSEKACSSLYSAESLRESNVNI
EDFLSKSQDEHARDVAVGMQGSLLDEAFQNINSDLSETLQVSESQPVLRGASEDNAPFHQ
QSEYDFNTVLRPSAAWQGHVGVGENVFDEDDRRPQWNIHGYASDASIRVGEYVHQVDTYQ
PHSSAYGHSSDSHIKSSSYTSEVESRRPRWNVHGHVSEAHIKIGEYASEIETSRPRWNIH
GHASEANIKIGEYVSNVAPTRPRWSSHGHASDSNIKVGENVSEVVSARPRWNVHGHASQS
HIKIGELVSDTEPLKSRWSPFGHASQSSIQIGKWAPSTENDPIPHRKTISGSSSDSTIQT
LLYSEELSPAEGSRKEAKPLQVKEETLPQSQISDSVTDFPDAIKDEKKDNAIEKKQEVIA
DIVNKDPSSDSSQSLQREEPEKAIPQDTVPQETLSSEANALKEDEGKEEDTWKKEQAYLK
ALSDQYCIEKYQDSYDLMSEPPVSHLLHHVIPRSYTFPVDPMVQSATDETAVQLSELLSL
PVLMKRSITAPLVSHVSLVNKAIVDYYFVELNVEKHFEALRHFLLMEDGEFAQSLSDLLF
EKLGSGQTPGELLNPLVLNSILNKALQYSLHGDTQLASNLSFALKYLPEMFKPNAPDALS
CLELRYKVDWPLNIVITESCMNKYNKIFSFLLQLKHMVWTLKDVWFHLKRTALVSRASNS
VQFRQLQLYKHEMQHFVKVIQGYIANQILHVTWCEFGNKLSSVGNLEEIHRTHAEYLNKA
IFRGLLTEKAAPVMNIIHSIFSLILKFRSQLISQSWSFDAGKQMAVHPNFGLMQQSYNTF
KYYSHFLFKGCPKMVSKDQKQIFQDELEWLLPNSTGSQNTCGSHLSPYYEIYGCFMDRD
NT seq 7380 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcgctgatttatgatgaggagatgaccactcacaaactactttgg
agtgatcccatttgtgatattgaagtgccagaaagactttcatcctcctatgagcagctt
agaagttaccatcttgtggagagatgtgtccatgtacctgccagagaaggaagtgaggag
gagatcctgttggttcacagtttagagcacctggaagtggcaaaaagtactcagacaatg
aatgaggaggagctgaaaagggtctctgaaaattatgatgcttttttctttcatccgagc
actttccactgtgccagattagcagtaggagcaactttgcagctggtggatgctgtgatg
tcaggaaaagtgcgcaatggaatggcattagtcagacctccaggtcaccacagccagaga
aatgcagctaacgggttctgtttgttcaacaacgttgctattgcagcagaatatgcaaaa
ctgaaatatggtctgcagagaatcctaattgttgactgggatgtgcaccacgggcaagga
acccagtatatatttgaagaagatccaagtgttttgtacttttcttggcatcgctatgaa
catcaggaattctggccgtcactcaaagaatctgattatgatgctgtgggtctgggaaaa
ggaaaaggttttaacataaatttgccttggaataaggttgggatgggaaattcagattac
cttgctgcatttttccatgtgttgcttccgatggcttttgagtttgatcctgaactggta
attgtctcctccggatatgattctggaattggtgaccctgaaggtcagatgaatgccact
cctgaggttttttcccaccttacccatttcctgatgcagttagctaatggaaaactgtgt
gtcatcctagagggtggataccacttgaaatcattgggtgaatcagtgtgcatgactgta
aaaactttgcttggagatcctgtacctcaaataactggagaaatggcaccttgtctaagt
gctgttgaatctattcaaaatgtgagagcagcacataaaccctactggaaatggttggct
tatgaagatacatcatttttacaaaatttgagcaccaaatcacacttactaaagaagact
aattcaagtccctccacagaacttgaatctaagataactaacagtaacaacactgtcaaa
gtagaaaggtttttggaattgcacatgaaaaatattctatttccagtgcctcccatcaaa
acagcaacagctggctcagaaggttcagaacactttctccctgaacatgttcagcttgtg
aaggaaatggacaaaagtgaagtaaaagctcttgtcagtggcttttatgcagacctcgtg
aaagaggatgaaactttgctctctcttggcagtatgtttgtgatcctagataaaatactg
aagaaggaggtgtgtaatggaattgcagcaacacccacagctggtctttctgctgctgtt
gcactaagacattctgttcattttggattacaaagagtgctttgtgtatttgttggagac
atgcagatgataccaaacacagaagatggaagaatgcttatcataaacatctgtgagaaa
gaacagtctgaaaagagcagctgcaaacactatatttctctaaactggaaagaggatgct
gaaggaaatgatttcttttctgctgtacttggattcattcttcctgtagcatatagttac
caaccaaacttaacagttatagctgttggaccaaacaggagccttggaataagtgggatt
tctctccttgttgctttactgcaagggttagctgagtctcgaatttttgctgtgattgag
gacacagagataagtttaatgcaaagtgtagccaaagccttactgggtgcttctacacct
ccctttggaatttatgtacctcctacccaagaaaaagtaaataaaataaaagcattaaga
gaccagtttcagcaggaatggaaaatgcttcagtgttcaggtcttccttcccatgaaatc
agatatccagactgtaactgcccaaacccgacagtttcatttgaaatggagagcattaca
cagttgttcaatgacttgtgtgaagcacacttgacaggtttgccatggaaggttcactta
ggcaggcagaagatcagcaagaggagggctaagcaaaatctgaaaagggttgcttataat
gccctgttcatgaacctttttcaagatgaggctcgtaagctgcaatcgaatgtttccaga
ctcccagtgaagaacaaaattttgatgctgtctttcaacttgagagttgctggcctaggt
gctcaagcagatagactggagaatcttgtggaggagctggaagcagctgaatgtttacca
tttactgaagttaattctgtcttagatctcttagtacagcttgctggaacaggtcctcct
cagctggtaccacaaaaaaaggactattttctgaacaacaaatatgttgggaggaatgtc
aaataccagggatatgattattatgatgtaagtgtgtttgaagctgacatacagtctctg
ataacaaacgaagagtgtcagttcaatgacacgattcagcagacacttcagataatggag
gctgcacctggcactggactccctgccatagggctgttctcacagggctgtcctgctggg
gacaagtttgagaaggaaacgcgcgtctcactcttcggtgcgcttgtccacagccgtacg
tatgatatggacatcaagttggatttaccaccagtgcctgacaatgcagatctgtctgga
cttgcaattaaagttcctcaaagtatagaccagtcagaagatgagggattccagtcagca
tccaatctgactcctgattctcagtcagagccgagcatgactccagacatagacttatgg
gatgcagtgcttacatatggacccagcaaacgaagatgttgggaaagaattgggtaccca
cctggtaaaaaagaggaaccatatcttactgaagctggaagagaagcttttgacaaattt
tataaacttcgagaaggggagttacaactctttactaatactgtacttcagcttcctcag
cttgtgctggtgaaagaacctgaactggttaaggatgtcttgaatgtcctcattggtgtg
gtatccactacattttcactcaatcagtctgctcagtcatttgtgataaaggagggggtg
tatgtatctggaacatcaccagagacaatgcataacttgctctcggaagttgcagagtat
ggaacctattacacacggctaagtcgtttttctcttcagccagttttggattcctcatac
agcaaaggacttgtgtttcaggcattcacaagtggactgagaaagtatcttcaatattac
cgagcctgtgttttgtcaacacctcctactttaagtcttctaacaatcagctttttattc
aggaaattaggtcgtcagctgaggtatttagctgaactgtgtggcataggaacaacagca
ctggggatcagtggtggagctggtgcttcatttcctacgggtgttaaattgctttcatat
ctgtacaaagaggccctcaacaattgtagcaatgagcattatccagttcttctgtctttg
ttgaagacaagctgtgaaccatacacaagatttatctatgattgggtatacagtggtgta
ttcagagatgtttatggagaatttatgattcaggtgaatgaggattatctttgtttcaga
gataaacattattggactcatggttatgttttgatttcaaaagaagtggaagactgtgtc
cctgtatttcttaaacatattgctaatgatgtgtacatatgtgggaaaaccataaacttg
ctgaaattgtgctgtcctaggcattatatatgttggtcagatatacctgttccccggatt
tcagttattttttcacttgaagaactgaaagaaatagagagagattgtgcagtgtatgta
ggtcgaatggaaagaattgcccgatacagttccataagcaaggaggaaaaggatttgcgc
atggaaatagccaaacaagaattaatagttcatgctcgggaaactgctagcaaagtacta
aaagccattagtgacaagcaagtatcagaacgaatggctttggatgcaaagaaacgggaa
cagtttcagaagctgaaagaacagtttgcaaaggaccaagagcgtcgtcttgccataagg
caggaggagattgatgatgatttcagctatgcccgagagctgagagagagagaaaaaaga
ctgaaagctttagaagaagaactggaaaaaaaggcaaggcaggaattaattgaccattac
agcaaactctctgatgatgcagcccgtagggaacaaagaacgttatggaaaatccagcgc
cacaagttggaaacagcccgtcttaagtttctgttagaagatcaaaaacacattgaggaa
atgcttgaaaaacttccagatgaaaactacaggagaaaattagatattattccttttaaa
cagtgccagttggctttggataaaaaccctgttgacaaagatccaccttcagaagtgtct
tttgtgaaacctctgcaatctaatgagacagttgccagaatagaatctgagcctgagcag
ggatatgctgctgctgctgctgctgacaaagcactgcccatgccagagccagaaaataat
aatgctgatgagcattttcagcctaaagcaataggatctgaaagcagtctccaaaattca
gagaaagcatgcagttctctatacagtgctgagtccttgcgtgaatccaatgtgaatata
gaagatttcttatcaaagtcacaagatgaacatgcaagagatgttgctgttgggatgcaa
ggatctttgctagatgaagctttccaaaatattaactcagatctttctgagaccttgcaa
gtgagtgaaagtcagcctgtcttgaggggagcatcagaagacaatgcaccatttcatcag
caaagcgagtatgattttaatacagttctcagaccatctgcagcttggcagggacatgtt
ggagttggggaaaatgtatttgatgaggatgacagaaggcctcagtggaatattcatgga
tatgcatctgatgccagcattagagtgggagaatatgtacatcaagtggacacttaccag
ccacattcaagtgcttatgggcattcctcagattcccatataaaaagcagcagctatact
tctgaagttgaatctagacgaccccgatggaatgttcatgggcatgtttctgaagctcat
attaaaattggggaatatgcttcagagatagagacctcaaggcccaggtggaacatccat
ggacatgcttctgaagccaacattaagattggagagtatgtgtcaaatgtagctcctaca
aggcctcgatggagcagccatggtcatgcatctgattccaatatcaaggttggtgaaaat
gtgtcagaggtggtctcagccagacctcgttggaacgtccatgggcacgcttcacagtca
cacatcaaaatcggagaactggtttcagatacagagcctttgaaatcccgttggagccca
tttggacatgcatcccagtcgagcatccaaatagggaagtgggctccatctacagaaaat
gatcccatacctcatcgtaaaaccatttcgggttcttcatctgactccacaatccagaca
cttctctacagtgaagagttatctcctgctgaagggagcagaaaggaagcaaaaccactg
caagttaaggaagagactttgccacagtcacagatatctgacagtgttacagactttcct
gatgctattaaagatgaaaaaaaggataatgcaatagaaaagaaacaagaagtaattgca
gatattgtcaataaggacccttcttcagattcctcacagagcttacagagagaagaacct
gaaaaagccattccacaagatactgtgcctcaagaaactttatcttctgaagctaatgct
ctcaaggaggatgaaggcaaagaggaagatacatggaagaaagaacaagcttatttgaaa
gccttatcggatcagtattgtattgaaaagtatcaagatagttatgatttgatgtcagaa
ccaccagtttctcatctcttgcatcacgtgataccaagatcgtacacatttcctgtggat
cctatggtgcagtctgcaacagatgaaactgctgtacagctgagtgagctcttgtctctg
ccagtgctgatgaaacgttctattactgctccacttgtatctcatgtttctcttgtgaac
aaagcaatagttgattactactttgtggagctgaatgtagagaagcattttgaagcattg
agacactttttgttaatggaagatggggagtttgctcagtcactcagtgacctgttgttt
gagaagcttggatcaggacaaacacctggtgaattgctgaatccactggttcttaattct
atcctaaataaagcgctacagtacagtcttcatggtgacacccagcttgcttccaatctt
tcttttgccctcaagtatctcccagaaatgttcaagcccaatgctccagatgctctgagt
tgcttagagctcaggtacaaggttgactggcctctgaatattgtcattactgagagctgc
atgaataaatacaacaagattttctcctttttgcttcagctgaagcacatggtgtggact
ctcaaggatgtttggtttcacttaaaacgcactgctttggtgagtcgtgcatcgaattct
gttcagtttcgacagctccagttatataaacatgagatgcagcattttgtgaaagtaatt
caaggttatattgctaatcagattcttcatgttacatggtgtgaatttggaaacaaactg
tcttctgtgggcaacctagaagaaattcatagaacacatgctgaatacctcaacaaagca
atcttcaggggtctgttgacagagaaggcagcccctgtgatgaacatcatccatagcatc
ttcagccttattttaaagttccgcagccagctcatctctcagtcgtggagcttcgatgca
gggaagcaaatggctgttcatcccaactttggtctgatgcagcagtcatacaataccttc
aagtattactcccatttcttattcaaagggtgtccaaaaatggtatcaaaggaccaaaaa
cagatatttcaggatgagttagaatggctgcttccaaattctacaggaagtcagaacacc
tgtgggagccacctaagcccatactacgagatctatggttgcttcatggacagagattaa

DBGET integrated database retrieval system