KEGG   Parus major (Great Tit): 107204742Help
Entry
107204742         CDS       T04864                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107204742
   00500 Starch and sucrose metabolism
    107204742
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107204742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107204742
NCBI-ProteinID: XP_015483890
LinkDB All DBs
Position
1A
AA seq 887 aa AA seqDB search
MARMRSLCFLAAVLAVLGGCLGSEQEQCPGAVAVQRRIDCHPQPGASREACEARGCTWCS
SDVPNAPWCFFPEDSPYGYARSGNVEETAQGWRVTLNKRQALTLFGNDISPIVLEVEFQT
KDRLRFRLYDPNKQRFEVPLKISGPGVTAEEANYEVEFSDDSTHFTIRRKSTGTVLWDSP
LVDLFFSNQFLQITTTVPSTSVYGFGEHEHPTFKHNMDFVTYGMFSRDQAPTSFANLYGV
HPFYMCVEPDSNAHGVLLLNSNAQDVTLSPNPSLIFRTVGGILDFYLFMGPTPENVVQQY
TEAIGRPHMPAYWSLGFQLSRWGYGSLDVLKETVDRMKHYDIPYDVQHFDIDYMERRLDF
TYDKVNFAGLPEFMKEMKKNGKHNVVILDPFITKDEEPGTYRPYELGQEMGVWVNNSDGV
TPAVGKAWPPGDSVFPDYTNPRTVEWWTQLCLEFKDVLDYDGIWIDMNEPSNFMRGQYPG
CADNEINNPPYIPRISDRSLAEKTLCPDSKTYLGDHYNTHSLFGWAQTEPTFNVVQQATG
KRAFVLSRSTFVGSGKHSAHWLGDNFSQWKDLRRSIVGILEFNLFGIPYVGADICGFNYN
TTYELCLRWMQLGSFYPFSRNHNAEGNSEQDPAVFGDAFAKISRATLRIRYSLLPYLYTL
FYESHVHGGTVVRSLMHEFTSDQETHGIDTAFLWGSAFMIAPVLEEGARSVTVYFPEAQW
FDYYTGLKVPSAWKKNYATVSAPLNKIPLYIRGGYILPQQAPATTTTESRLNPFGLIIAL
DEQGQASGSLFWDDGDSIDTIEKENYFLAKYTFSKGSLKTEIVKNGYRGADTLKYNKITI
LGLKLRPQAVSLNGRSIRGDAVSYEMSGKLVLQISVPLTQELNMKFY
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggatgaggagcctgtgtttcttggctgctgtgctcgcagtcctgggggggtgc
ctgggctcggagcaggagcagtgcccgggcgccgtggcggtgcagaggcgcatcgactgc
cacccgcagcccggcgcctcccgggaggcctgcgaggcgcggggctgcacctggtgctcc
agcgacgtccccaacgctccctggtgcttcttccctgaggacagtccctacggctacgcc
cggagtgggaacgtcgaggagacggcccaaggctggagggtcacactgaacaagcgccag
gccttgaccctcttcggaaatgacatttccccaatcgtcttggaagtggagttccagaca
aaggacaggctccggttcaggctctacgaccccaacaagcagcgatttgaagtcccactc
aagatcagtggccccggggttaccgctgaagaagccaactatgaggtggagttctcggat
gattccacgcacttcacgatcaggaggaaaagcactggcaccgtgctgtgggacagtccc
ctggttgatctgtttttctccaaccagttccttcagatcaccaccactgtgccatccact
tctgtgtatgggtttggtgaacatgagcacccgaccttcaagcacaacatggactttgtt
acctatggcatgttctccagggaccaggcaccaacgtcatttgccaacctctatggagtt
caccctttctatatgtgcgtagaaccagactccaatgcccatggtgttctccttctgaac
tctaatgcacaagatgttactctgtctccaaacccatctttaattttccgcactgttgga
gggatccttgacttctatctcttcatgggaccgactcctgaaaacgtggttcagcaatac
actgaggccattggacgcccacacatgccagcctactggtctctgggattccagctctcc
cgctggggctatggcagccttgatgtcttaaaggaaaccgtcgatcgcatgaagcactat
gacatcccatatgatgtccaacattttgatattgactacatggaacgtcgcctggacttt
acctatgataaagtgaattttgctggtctgcctgagttcatgaaggagatgaagaagaac
ggaaagcacaatgttgtgattctggaccctttcataaccaaggatgaggagccaggcact
tacagaccttacgaactcggccaggaaatgggagtatgggtgaacaactctgatggtgtg
actcctgctgttgggaaggcctggcctcctggagattctgtgtttcctgactacaccaac
cccaggacagtggaatggtggacccaattgtgtctggagtttaaggatgtccttgactac
gatgggatctggattgatatgaatgaaccatccaatttcatgagaggccagtatcctgga
tgtgcagataatgaaatcaataaccctccttatattcctagaatctctgatcgttccctg
gcggaaaagacgctgtgtcctgactccaagacttacctcggagaccattacaacacacac
tccctctttggctgggcacagacagaaccaactttcaatgttgtccagcaggcaactgga
aagcgggcgtttgtcttgagtcgttccacgttcgtgggcagcgggaagcacagcgctcac
tggctcggtgacaacttctctcagtggaaggacctgcgccgctccatcgttggaatcctg
gaattcaacctctttggcattccctatgttggtgctgatatctgtgggtttaactacaac
actacctatgaactctgcctgcgctggatgcagcttggctctttctatccattttccaga
aatcacaatgcagagggaaatagtgaacaagacccagcagtgtttggagatgcttttgcc
aagatatctcgtgctactcttcggatcagatactccctgctgccatacttatacaccctg
ttctacgagtctcacgttcacggaggcacagtggtgcggtcactgatgcacgaatttacc
tctgatcaggagactcatggaatagatactgccttcctttggggatcggcctttatgatt
gctcctgttcttgaagagggagcaagatctgtgactgtatacttccctgaagcacagtgg
ttcgactactataccggtcttaaagtgccaagtgcctggaagaagaactatgccactgtg
tctgccccactgaacaagatccccctgtacatccgtggagggtacattctgccacaacag
gcaccagccacaaccactactgagagccgcctgaacccatttggactcattattgccctg
gatgagcaaggacaagcttctggatctctcttttgggatgatggtgattccattgatact
attgaaaaagagaactacttcttggctaaatacacattcagcaaaggaagcctgaagaca
gaaatagtaaaaaatggataccgtggagctgacactctgaagtacaacaaaattaccatt
cttggcctgaaactgagacctcaagctgtgtctctgaatggaagatccatccgtggagat
gctgtgtcttatgagatgagtgggaaactggttttgcagatttctgttccacttactcag
gaactcaacatgaagttttactag

DBGET integrated database retrieval system