KEGG   Parus major (Great Tit): 107205059Help
Entry
107205059         CDS       T04864                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00500  Starch and sucrose metabolism
pmaj01100  Metabolic pathways
pmaj04910  Insulin signaling pathway
Module
pmaj_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107205059 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107205059 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmaj01003]
    107205059 (GYS2)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107205059 (GYS2)
Glycosyltransferases [BR:pmaj01003]
 Polysaccharide
  Storage polysaccharide
   107205059 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 107205059
NCBI-ProteinID: XP_015484667
LinkDB All DBs
Position
1A
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQCEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWEVSNIGIPFQDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKSPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLKGEIPDLNKI
LDRDDISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWK
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRFPRPSSVPPSPSASQHSSPHHSEA
EDEDEDERYDEDEEAERDRQNIKSPFSIGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgagatccttgtccatgacatctctgaatgggcttcctcagtgtgaggat
gaagacctgcccgtggaggatttgttgctctttgaaatttcctgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactacagcagatgaatggggt
gaaaactatttcctgattggcccctattttgagcagaatgtgaagactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacaccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcttggaacctggacaagtggaaaggtgaattttgggaagtcagcaacata
ggaatcccttttcaggaccgagaagccaatgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgacaagcctaatataattgcccatttc
catgagtggcaggcaggagtgggtttaatcctgtctcgatcacagaaactccctgtcgcc
acaatttttactacccatgcaactctgctagggagatacttgtgtgcagccagtattgac
ttttacaacaacctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggagcgggcatctgtacactgtgcccacgtgttcaccacagtctct
cagatcacagctacagaagcagaacatatgcttaaaaaaagccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagactttgtttttcttcattgctgggagatatgaattttcaaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgat
gttacagttattgtgttcttcatcatgccagcaaagaccaacaatttcaatgtggaaacc
ttgaaaggacaagcagtccgtaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaagaaagctctacaatgccttgctgaaaggagaaatcccagacttgaacaagatt
cttgaccgagatgacataagcattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaatgacccaatcctcaacacc
atccggcgcattgggctgttcaacaaccgcacagaccgcgtgaaagtgatcctacatccg
gagtttctttcttcaacaagccccttgctgcccttggactatgaggagtttgttagaggc
tgccaccttggtgtattcccatcttactatgaaccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggatttggctgtttcatgcag
gaacatgttgctgacccagaagcttacgggatctacatcgtggacaggaggttccgctcg
ccggacgagtcgtgcaaccagctgacccagttcctgtacgggttctgccagcagaaccgg
cgccagaggatcatccagaggaaccgcactgagcgtctctcggacctcctggactggaaa
tacctgggcaggtattacatgcatgccagacacttggccctcagcagaacgttcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggttccccaggcct
tcatcagtgccgccatcaccctctgcctcccagcattctagcccccaccacagcgaagcc
gaggacgaagatgaggatgagagatacgacgaggatgaggaagctgaaagggacaggcag
aacatcaagtcccccttttccattggagccttgccacaaggaaaaaagaagcagcatgga
gaatacaggaactga

DBGET integrated database retrieval system