KEGG   Parus major (Great Tit): 107205063
Entry
107205063         CDS       T04864                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107205063 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107205063 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmaj04052]
    107205063 (KITLG)
Cytokines and growth factors [BR:pmaj04052]
 Growth factors
  Growth factors (RTK binding)
   107205063 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107205063
NCBI-ProteinID: XP_015484673
LinkDB
Position
1A
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFSDIPDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADRLDKNDCILPSTVGTPENDS
RVAVTKTFLFPPVAASSLRNDSIGSSTNSNKEALGFISSSSLQGISIALTSLLSLLIGFI
LGAIYWKKIHPKSRPESDETTQCHDYQEENEISVLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactactcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtcacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatctgataacccttaaatatgtcccgaag
atggatagtctgcctaatcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctgcataatcttctccagaaattttcagatattccagatatgtcggatgttttaagcaac
tattcaatcatcaacaatctcacaaggataattaatgatcttatggcatgccttgctttt
gataaaaacaaggattttgtaaaagaaaatggtcacctttatgaagaaggtcacttcatt
cctgaggacttttttaggcactttaatagtaccattgaggtctacaaagagtctgcagac
agattggataagaatgactgcattctgccttcaacagtaggaacaccggaaaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctctcttaggaat
gacagcattggcagtagcactaacagtaacaaagaagcacttggcttcattagcagctcc
agcctgcaagggatcagcatagctctgacatcattgctgtctctccttattggctttatt
ttgggagccatatactggaagaaaatacatcccaaatccagaccagaaagtgatgaaact
acacagtgtcatgactatcaagaggaaaatgagataagtgtgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system