KEGG   Parus major (Great Tit): 107205142Help
Entry
107205142         CDS       T04864                                 

Gene name
B3GALT5
Definition
(RefSeq) beta-1,3-galactosyltransferase 5
  KO
K03877  beta-1,3-galactosyltransferase 5 [EC:2.4.1.-]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pmaj00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pmaj01100  Metabolic pathways
Module
pmaj_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107205142 (B3GALT5)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107205142 (B3GALT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmaj01003]
    107205142 (B3GALT5)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     107205142 (B3GALT5)
Glycosyltransferases [BR:pmaj01003]
 Glycan extension
  Type 1 chain
   107205142 (B3GALT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 107205142
NCBI-ProteinID: XP_015484858
LinkDB All DBs
Position
1
AA seq 344 aa AA seqDB search
MKMRGTWLGVPIGHLLALGHRNKWRNMVDSRKFRVFVCLLGLSSASLWALYSWMELCVLC
ESSQGYIFPTGTFRRVEGNFSQLPDIDCHKNPPFLVLLVASSFQQVDARMAIRHTWGKER
TVAGKRLVTFFLLGSPVDPSQQADIAAESQRYRDIIQKNFTDTYYNLTLKTMMGIEWIHR
FCSQSSFAMKTDTDVFVNVFYLTELLLRKKKTAGFFTGFLKLHEYPIRTRGSKWHVSREE
YPGTTYPPFCSGTGYVLSSDVASQIYNISESVPFIKLEDVFIGLCLDKLKIGLEELHSEQ
TFFPERIRFSVPRFKKIVTCHGIKPSEQLSYWNHLVAGAPGGVL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagaggaacctggctgggtgtgcccattggacacctgctggctctgggacac
aggaacaaatggagaaatatggtggattccagaaagttcagggtgtttgtctgcctgctg
gggctcagcagtgccagcctctgggctctctacagctggatggagctctgcgtgctgtgt
gagagcagccagggttacatcttccccacggggactttcaggagggtggaagggaacttc
tcacagctcccagacatcgactgccacaagaaccctcctttcctcgtcctgctcgtggcc
tcctcgttccagcaggtggatgccaggatggccatccggcacacctggggcaaggagagg
acagtggctggcaagcgcctggtgacgtttttcctcctggggagccccgtggatcccagc
cagcaggctgacatcgctgctgagagccagaggtacagagacatcatccagaagaacttt
acagacacctattacaacctgaccctgaagaccatgatggggatcgagtggattcacagg
ttttgttcccagtccagctttgccatgaaaactgacaccgacgtgtttgtcaacgttttt
tacctcactgagctgctcctgaggaaaaagaagactgctggattcttcacaggcttttta
aaactgcacgagtaccccatcaggacaagagggagtaaatggcatgtgagtagggaagag
tacccaggaacgacctatccacccttttgttctgggactggatatgttttatccagtgat
gtagccagccagatctacaacatttctgagagtgttccattcattaaactggaggatgtg
ttcataggactgtgccttgacaaattaaaaattgggctggaggagcttcactcggagcag
acgtttttcccagaaaggatcaggttctctgttcctcgctttaagaaaatcgtgacgtgc
catggaataaaaccctctgagcagctgagctactggaaccacttggtggcaggagctcca
ggaggagtgctctag

DBGET integrated database retrieval system