KEGG   Parus major (Great Tit): 107205837Help
Entry
107205837         CDS       T04864                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107205837 (GANC)
   00500 Starch and sucrose metabolism
    107205837 (GANC)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107205837 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 107205837
NCBI-ProteinID: XP_015486313
LinkDB All DBs
Position
5
AA seq 914 aa AA seqDB search
MEAGTPGGVSVQDEAVDKSNFKKCNQIAFYRRQKLLHPGKSLYRVLLDSVTLSDENVKFQ
IIHEENKVLLQVEIYEIEGNIFRLKIDEASPLRPRYKVPDVLIKEPTTKRLFISHKEAGI
LVLSSANEDYKLQVTSNPFQVELQSKGETVMSMNSNGLLYFEHLQPPPSDRKPTVQNEEA
ASDSSKEKQEDLGLWQEKFGNFLDIKAHGPTSVGMDFSLHGYDHVYGIPQHTETLLLKNT
SDGDAYRLYNLDIFGHKIHEKIGIYGSVPLLLAHKPNRTSGIFWLNSSETLVDISTKAVA
EHTPSRSAAETAKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDTFKQFAQLTGTQALPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDAHDIPYDVIWLDIEHTDGKRYFTWDKQKFQNPRK
MQEHLRKKKRKLVVIVDPHIKVDPSYTLYAQAKEKGYFVKDRNGQDFEGISWPGSSCYPD
FTNPEVRKWYADQFAFKTYKASTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHREV
HNLYGFYQQMATAEGLIRRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTADWSYLKISIP
MLLTINMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRSHSNMESKRREPWLFGE
KNTQIIRRAIRERYVLLPYLYTLFYRAHTAAEPVMRSLWIEFPEKMETFDVENEYMLGNA
LLVHPVTEKETKTVAVLFPGPEEIWYDFRKFKRIEDAGTVKIPVTLENIPVFQRGGTVIP
LKTTAGKSTEWMIDISYELHVALDTEACAIGELYIDDGHSFQYLHKKQFLYRKFTFHKNI
LSSSCIGESGQYHTTCVVERVIILGFGKHPTSVTASPKDGKKTEVVFTYDTKTSALTLEN
LALSVDADWEICIS
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggacgccggggggagtcagtgtccaagatgaggctgtggacaaaagcaac
tttaagaaatgcaaccaaattgctttttacaggcgtcagaaacttctacatcctggaaaa
tccttgtatcgagtgttgttggattcagtcacattaagtgatgagaatgtcaaattccaa
atcattcatgaggagaataaggttcttctacaagtagaaatttatgaaatagaaggcaat
attttcaggcttaaaatcgatgaggcatctcctctcagaccaaggtacaaagttcctgat
gttcttataaaggaacctaccaccaagagactcttcatatcccacaaggaggcaggtatt
ttggtactgtcaagtgctaatgaggactacaaacttcaagtcacatcaaaccccttccaa
gttgagctgcagtccaagggtgagactgttatgagcatgaattccaatgggttgttgtat
tttgagcacctacaacctcctcccagtgacagaaaacctacagtacaaaatgaggaggca
gcaagtgattcctctaaggaaaaacaagaggatctaggtctctggcaagagaaatttggc
aatttcttagacatcaaagctcatggtcctacttctgtaggcatggacttctctttacat
ggatatgaccatgtttatggaataccacaacacacagaaacacttcttcttaaaaacacc
agtgatggtgatgcctaccggctatataatttggatattttcggccacaagatacatgaa
aaaataggtatttatggttcagtaccccttctcttagcacacaagcctaacagaacttca
gggatcttctggctgaactcttcagaaacactggtggatattagtacaaaggcagtagct
gagcacactccatccagatctgctgcagagactgctaagcagagagcagtgcctctaact
gacgtacgctggatgtcagaaagtgggatcattgatgttttcctgctgatgggacccact
gcatttgataccttcaagcagtttgcacaactgacaggcactcaagcattgcccccactt
ttttctctgggctaccatcagtgcaggtggaattatgaggatgagcaagatgtcaaggca
gtggatgctggctttgatgcacatgacattccttatgatgtcatatggctggatatagag
cacacagatggaaagagatattttacttgggacaaacagaaattccagaaccccagaaag
atgcaagagcatctcaggaagaaaaaacgcaagcttgtggtcattgtagaccctcatatt
aaggttgatccctcatataccctgtatgcacaggcaaaagaaaagggatattttgtgaaa
gacagaaatgggcaagattttgagggcatcagttggccaggttcctcttgttacccagat
ttcaccaatcctgaagtgcgaaaatggtatgcagatcaatttgccttcaaaacatacaag
gcatccactaatatcctctttgtatggaatgatatgaatgagccttcagtcttcaagggg
gcagagctaacaatgcagaaggatgctgtgcattacaacaactgggagcaccgggaagta
cacaacctctatggattctaccagcaaatggcaactgcagaaggactcatcagacgttct
tcaggaaaagagagaccatttgtactcacacgatctttctttgctggatcacagaagtat
ggggcagtgtggactggagacaacacagcagactggagttacctgaaaatatccattcca
atgcttcttaccatcaacatggcagggatttcattctgtggagctgatgtgggagggttt
attggagatccagagccagagttacttgttcgctggtatcaggcgggagcctaccagccc
ttcttcagaagtcactctaacatggagagcaaacggcgcgaaccgtggctctttggggag
aagaacacccagatcatcaggagagccattagagagcgctacgtcctcctgccctactta
tacactctgttctatcgggcacacacggcggctgaacccgtcatgaggtctctctggata
gagtttccagagaaaatggaaacttttgatgtggaaaatgagtacatgctgggaaatgct
ttgttggtgcatccagtcacagagaaagagaccaagacagtggcagttctgtttccaggg
ccagaggagatttggtatgatttcagaaaatttaagcgaatagaagatgcaggcacagtg
aagatcccagtaacactggagaatattcctgtattccagcgggggggcactgtgatacct
ctgaagaccacagctggaaaatccactgaatggatgatagatatttcttatgaactccac
gtggccttagatacagaggcctgtgccataggtgagctctacatagatgatgggcattca
tttcaatatctccacaagaaacagttcctgtatcggaaattcactttccacaagaacatt
ctctcttccagctgcataggtgaaagtggacagtaccacactacatgtgtagttgaacgg
gtgattattctgggatttggaaagcatcccacttcagtgacagccagtcccaaggatggg
aaaaaaacagaagtggttttcacatatgatacgaagacctctgcgctgacactggaaaac
ttagccctgagtgttgatgctgactgggagatctgtatcagctga

DBGET integrated database retrieval system