KEGG   Parus major (Great Tit): 107205992
Entry
107205992         CDS       T04864                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04068  FoxO signaling pathway
pmaj04110  Cell cycle
pmaj04115  p53 signaling pathway
pmaj04218  Cellular senescence
pmaj04310  Wnt signaling pathway
pmaj04340  Hedgehog signaling pathway
pmaj04371  Apelin signaling pathway
pmaj04510  Focal adhesion
pmaj04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107205992 (CCND1)
   04340 Hedgehog signaling pathway
    107205992 (CCND1)
   04371 Apelin signaling pathway
    107205992 (CCND1)
   04068 FoxO signaling pathway
    107205992 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107205992 (CCND1)
   04115 p53 signaling pathway
    107205992 (CCND1)
   04218 Cellular senescence
    107205992 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107205992 (CCND1)
   04530 Tight junction
    107205992 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107205992
NCBI-ProteinID: XP_015486685
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctatttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgagtccctcctcgagtccagtctacgc
caggcacagcagcacaatgtatcttcagaaacaaagactgtagaggacgaagcagacctc
tcctgcacacctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system