KEGG   Parus major (Great Tit): 107206960Help
Entry
107206960         CDS       T04864                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00010  Glycolysis / Gluconeogenesis
pmaj00051  Fructose and mannose metabolism
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj00520  Amino sugar and nucleotide sugar metabolism
pmaj00524  Neomycin, kanamycin and gentamicin biosynthesis
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
pmaj04910  Insulin signaling pathway
Module
pmaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmaj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107206960
   00051 Fructose and mannose metabolism
    107206960
   00052 Galactose metabolism
    107206960
   00500 Starch and sucrose metabolism
    107206960
   00520 Amino sugar and nucleotide sugar metabolism
    107206960
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107206960
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107206960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmaj04131]
    107206960
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107206960
Membrane trafficking [BR:pmaj04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107206960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 107206960
NCBI-ProteinID: XP_015488972
LinkDB All DBs
Position
6
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAA
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQTKLDEGILITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSPEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMKNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTTYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLERLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLREAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgataagtacctctacgccatgcggctctctgacgaaacgctgctggacgtcatg
gctcgcttcaggagagagatgaagaacggcctctccagggattttaacccaacagctgcg
gtgaagatgcttcccacctttgtgaggtccattcctgacggttcagagaaaggagatttc
attgcgctggatctcggcggttcttacttccgaattcttcgggtcaaggtatcgcatgaa
aaaaagcagacggtgcagatggaaagtgaaatttataataccccagaagacatcatgcat
gggagtggaacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactgccagtcgggtttacattctccttcccctgtcgacaa
accaagctagatgagggtattctgataacctggacgaagcgcttcaaagcgagcggagta
gagggagcagatgtcgtgaggctgcttaacaaggccatcaagaaacgtggggactacgat
gcggatatcatggctgtggtcaacgacaccgtggggaccatgatgacctgtggcttcgac
gaccagcgctgcgaagtcggcttgatcatcggcaccggcaccaacgcctgctacatggag
gagatgcggcacatcgacctggtggagggggatgagggcaggatgtgcatcaacaccgag
tggggggccttcggagatgacggctcgctggaggacatcaggaccgagttcgatcgagag
attgaccgcggatcccttaatcctgggaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaagggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagaaggtttgaacaaagccaaagaaatcctgacccggctgggg
gtggagccgtcccccgaggactgcatcgctgtccagcacgtctgcaccatcgtgtccttc
cgctcggccaacctggtggcctccaccctgggcgccatcctcaaccagctgcgggataac
aagggcgtgggccggctccggaccaccgtgggggtggatggctccctctacaagatgcac
ccacagtacgcccggcgcttgcacaaaaccacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtcggagagcggcagcgggaagggggcggccatggtgacggccgtggcg
taccggctgtcggagcagcaccgcctcatcgacgagaccctggccgagttcaaactcacc
catgagcagctgctgcaggtgaagaagaggatgagggcagagatggaagcggggctgaag
aagaagactcacgagacggccaaagtgaaaatgctgcccaccttcgtccgcagcacgccg
gatgggacagagaatggagactttctggcacttgaccttggaggaacaaactttagagtt
ttgctggtgaaaatccgcagcggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcccatagaagtgatgcagggaacaggagaagagctgtttgatcacatcgttacc
tgcatttctgacttcctggattatatggggataaaaggcgctcgtcttcctcttggcttc
accttttccttcccttgcaagcagaccagcctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgtgagggagaagatgtggtatatttacttagagaagga
attaaaagaagagaggaatttgacttggatgtggtggctgtggtgaatgatacagtgggc
acaatgatgacttgtgcttatgaagatccaaactgtgaaattgggctcattgtgggaacg
ggcagcaatgcctgctacatggaggagatgaaaaacatagagatggtggatggtgagcaa
gggcggatgtgtgtgaacacggagtggggagcgttcggggacaacgggtgcctggacgac
atcaggacaacatatgacaaggcagtggatgacttctcactgaatgctggaaagcaaagg
tatgagaaaatgatcagtgggatgtacctgggggaaatagtccgcaatattttgatcgac
ttcaccaaacggggtttcctgttccgaggccagatttcagagacactgaagaccagacat
atctttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcaggtg
cgaaccatcctccagcagctggggctcaacagcacctgtgacgacagtatcatcgtcaag
acggtctgcggggcggtgtcgaggcgagcagctcagctgtgtggtgctggaatggctgcc
attgtagataaaattagggagaacagagggttagagcgcctggagataacggttggtgtg
gatggcactctctacaaactccacccacacttttcgaggatcatgcaccaaacagtcaaa
gacctggcacccaactgcgacgtgaccttcctgctgtcggaggacggcagcgggaaaggg
gcagcgctcatcacagcggtgggatgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system