KEGG   Parus major (Great Tit): 107207043Help
Entry
107207043         CDS       T04864                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X2
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107207043 (RET)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107207043 (RET)
Protein kinases [BR:pmaj01001]
 Receptor tyrosine kinases (RTK)
  RET family
   107207043 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD3 RET_CLD1 Pkinase RET_CLD4 Cadherin RIO1 Cadherin_2 Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107207043
NCBI-ProteinID: XP_015489162
LinkDB All DBs
Position
6
AA seq 1065 aa AA seqDB search
MRSAARTAAFLLLCGVALGLYFPRKEYLENVYIDAPAGMPLLHIHALKDSREESAHFHLC
QNLIISRARSHENNWFQIREKTGLLYLSKSLDREDFNMLSVGNWMPLSKVMLYVFLSSHP
FQERECDSATRTTVFLSLINATAPACSSLTARQLCFTEMDLSFHIKENKPPGTFHQLQLP
SVHHLCQNLSISYKLLAAEGVPFRYNENTTSVRVTRSLDREERERYELIAKCTVREGFRE
MQVEVPFLVNVLDEDDSPPFLPNGTDTADAVVEFNRKEGTVLSTLTVYDADTTPIYPLES
SRKKYTGTIITDDPWISETFRVEHIFDEIHFNPNGSQVRGTRHEYKLVLNKSISVTEHRS
FQLDVLVNDTEFQGPERSVMLHFNVSILPVSIQFSNITYQFTVNRNAERFAQIGKICIEN
CMKFRGVNITYKLLSPNTSCYPVSILQGREDKYGSLYVNDSSVLRRPECKEIQYTVQATD
KQSRKHTKTLLTLVLEGTLLRKEEDCPDSCAISKHRAECEECGGLGVLTGRCQWRQGSGK
GITTNYSTCTPSIKTCPDGICDVVEGRDPAVCPQDCTSGNIIGGHGKGTGNLGIKSGHGI
CYCFPRQNCYCEKDDIKEQLCDDVCKTVITAAVVLCFVISMLVSYYCIHRYHKNSPKPPI
ASAEMTFRRPAQSYPISYSSSNVRRPSLDSMENQVSVDTFKIPEDPKWEFPRKNLVLGKT
LGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLLKQVNHPHVIK
LYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYVGSDGNRNSSYLDNPDERALTMG
DLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRS
KGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLKTGYR
MERPENCSEEMYNLMLRCWKQEPDKRPTFTEISKELEKMMVKSRDYLDLAASTPSDSLLY
DDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGLYPMVLYPEDP
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggcggcgcggacagccgcgttcctcctgctctgcggggtggccttgggtctc
tacttccccaggaaggagtacctggagaatgtctacattgatgcaccagcaggaatgccg
ctcctgcacatccatgccttgaaggattcacgtgaggaatcagctcactttcatctgtgc
cagaatctcataatttctcgagcaagatcgcatgaaaataattggttccaaattagagaa
aaaacaggacttctctacctcagcaaaagcctggatagagaggattttaacatgctgtct
gtaggaaattggatgccgttatccaaggtgatgctgtatgtcttcctttcatcccaccct
ttccaagagagggaatgtgattccgctacacgcaccacggtttttctctctttgatcaat
gctacggcaccagcttgcagttccctgacagcaaggcagctttgcttcacagaaatggat
ctctcctttcacatcaaggagaataaaccacctggtacatttcatcagctccagttaccc
tcagttcatcatctgtgtcagaatctcagcatttcctacaaattgcttgcagctgaaggt
gttccctttcggtacaacgagaacaccaccagcgttcgggtgacgcggagcctggatcgg
gaggagagggagagatacgagctcattgccaagtgcaccgtcagagaggggttcagggaa
atgcaggttgaggtgcctttcctggtgaacgtgttagatgaagatgactctcctcccttc
cttcccaatggcactgatactgcagatgctgtcgtggagttcaacaggaaagagggcact
gttctttccacgctgaccgtgtacgatgcagacaccacacctatctacccccttgaaagc
agcagaaagaaatacacaggaaccatcattactgatgatccctggataagtgaaacattt
cgtgtagagcacatctttgatgaaatccacttcaacccaaatggcagccaagtgagggga
actcggcatgagtacaaactggtactgaataaaagcatttcagtcacagagcatcgttcc
ttccagctggatgttttggtgaacgacacagaatttcagggcccagaaagatcagtgatg
cttcatttcaatgtctccatcctccctgtcagcatccagttttcaaacataacttaccag
ttcacagtgaacagaaatgctgaacgcttcgcacaaataggaaagatctgcattgagaac
tgcatgaaattccgtggtgtaaacatcacctacaagctgctgtcccccaacacgagctgc
tatcctgtcagcattctgcaaggccgagaggacaaatatgggagcctttatgtgaacgat
tcctctgtgctgcgcagacctgagtgcaaggaaatacagtacactgttcaagctacagac
aagcagagcaggaaacacaccaaaaccctcctcactcttgtcctggaagggactctttta
aggaaagaggaggactgccccgactcctgtgctataagtaagcaccgtgctgaatgtgaa
gagtgtggtggcctgggagtgctaacaggaagatgccagtggagacaggggagtgggaaa
gggatcaccacaaactattccacgtgcacccccagcatcaagacttgtccggatggcatc
tgtgatgtggtggagggcagagacccggctgtgtgcccccaagactgcacaagtggaaac
attattggtggccatgggaagggcaccggaaatcttggaattaagtcgggacatgggatt
tgttactgcttcccaagacagaactgttattgtgagaaagatgatatcaaagagcaactg
tgtgatgatgtgtgcaagacggtgatcacagcagcagtggtgctgtgcttcgtcatctcc
atgctggtttcttactattgcatccaccgttaccacaagaattccccgaagccgcccatc
gcctccgcggaaatgacgttccggcgcccggcacagtcctaccccatcagctattcctcc
agcaatgtccgccggccttccctggattccatggagaaccaggtgtccgtagacaccttc
aaaatccctgaagatccaaagtgggaattccctcggaagaacctcgtcctaggcaagact
cttggagaaggagaatttgggaaggttgtcaaggcgacagcgttccgactcaagggaagg
gctggctataccactgtggcagtgaaaatgttaaaagaaaatgcttcccagagtgagctg
cgagatctcctgtcagagttcaaccttctgaaacaagtcaaccatcctcatgtcatcaaa
ctttatggagcctgcagtcaagatggcccgctgtatttaattgtggaatacgccaaatac
ggctccttgcgcagtttcctcagggaaagtcgaaaagtgggcccgagctacgtgggcagt
gatggcaacagaaattccagttatttggataaccctgatgagagagccttaacgatggga
gatctgatatcgtttgcatggcagatatcccgagggatgcagtaccttgcggagatgaag
ctcgtgcatcgggatttagctgccaggaacgtgttggtggcagaagggcgcaaaatgaag
atttctgattttggcctctcacgtgatgtatatgaagaagattcgtatgtaaagaggagc
aagggtcgaatccctgtgaagtggatggccatagagtccctatttgaccatatctacaca
acacaaagtgatgtatggtcatttggagttctgctatgggagattgttactttaggaggc
aatccttaccccggtattgctcctgaaagactctttaacctcctaaaaacaggctataga
atggagaggccagaaaactgcagtgaagaaatgtacaacctcatgttgcgttgttggaag
caagaacctgataaaagaccaacatttactgagatcagcaaggaactagagaagatgatg
gtgaagagtagggactacttagacctggcggcttccacaccctccgattccttactgtac
gatgatgggctctcagaagaggagacacctctcgtggactgtaataatgctcccctccct
cgaaccctcccttccacatggattgaaaacaaactctatgggctttatcccatggtcctc
tacccagaagatccctga

DBGET integrated database retrieval system