KEGG   Parus major (Great Tit): 107208209Help
Entry
107208209         CDS       T04864                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00590  Arachidonic acid metabolism
pmaj01100  Metabolic pathways
pmaj04370  VEGF signaling pathway
pmaj04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107208209 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107208209 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107208209 (PTGS2)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107208209 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 107208209
NCBI-ProteinID: XP_015491816
LinkDB All DBs
Position
8
AA seq 706 aa AA seqDB search
MNEINSKSSISGAPRWQELAVARRQPRAVPSAGDRPSLTPASSGARPGRAGAGRGGKRNS
PLGSCFRPVTQLGSARYCHKYGMCSRGRHLELPSQPRQPSPAMPLLPLALLAALLAAGRA
ANPCCSNPCQNRGVCMSAGPDRYECDCTRTGYYGQNCTTPEFFTWLRLALKPSPNTVHYI
LTHYQGAWNIINNIPFLRDTIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRS
LPPVGLDCPTPMGVKGKKELPDSNLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFK
TDHKRGPAFTRALGHGVDLNHIYGETLERQLKLRLRKDGKLKYQMINGEMYPPTVRDTQA
EMLYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCDVLKHQHPDWDDEQLFQT
TRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLL
PDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKAS
IDQSRQMRYQSLNEYRKRFMLKPFRSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEK
PRPGAIFGETMVEMGAPFSLKGLMGNAICSPEYWKPSTFGGKVGFDIVNTASLQKLICNN
VKGCPFTAFHILPPEPTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaataaatagcaagtcgtcaatcagcggagccccgcgctggcaggagctcgct
gtggcacggcgccagccccgtgccgtcccctcagccggtgacaggccgtccctcacacct
gcctcgagcggggccaggccggggcgggccggggcgggccggggcgggaagagaaattcc
ccgctgggttcgtgcttccggccagtgactcagctgggctccgctcggtactgccataaa
tacgggatgtgcagcaggggacgacacttggagctgccgagccagccccgccagcccagc
cccgccatgccgctgctgcccctggccctgctggccgcgctcctggccgccggccgcgcc
gccaacccttgctgctcgaacccctgccagaacagaggtgtctgcatgagtgctgggcca
gatcgctacgagtgcgactgcaccaggacaggctactacgggcagaactgcaccacaccg
gaattcttcacgtggctgaggctagcactgaaaccatcaccaaacactgtccactacatc
ctcacccactaccaaggagcctggaatatcatcaacaacattcccttcctacgggacact
attatgagatatgtactaacttcaagatcacacttgattgacagcccaccaacttacaat
agtgactacagttacaaaagctgggaagcttattccaatctttcctactacacgagaagc
cttccaccagtaggacttgactgcccaacaccaatgggtgttaaaggcaagaaagagctc
ccagattcaaatctgattgtggagaagtttttgctgaggagaaagtttattcctgacccg
caaggcacaaatgtgatgttcacgttctttgcccagcacttcacccaccagttcttcaag
acggaccacaagcggggccctgccttcaccagagcgctcggccacggggttgacttgaac
cacatttatggagagactctggagagacaacttaaactgaggcttcgaaaggatggaaag
ctaaaataccagatgatcaatggagaaatgtacccgccgacggtgcgggacacacaggca
gagatgctgtacccaccccatgtgcctgagcacctgcagttctctgtggggcaggaggtg
ttcgggctggtgccagggctgatgatgtatgccacgatctggctgcgcgagcacaaccgc
gtctgtgacgtgctcaagcaccagcaccccgactgggacgatgagcagctcttccagacc
acccgtctcatactgataggagagacaatcaagatcgttatagaggactatgtgcagcac
ctgagcgggtaccacttcaagctgaagtttgaccccgagctgctgttcaaccagaggttc
cagtaccagaaccgcattgcagccgaattcaacaccctgtaccactggcacccactgctg
cctgacaccttccagatccatgaccaggagtacaccttccagcagttcctgtacaacaac
tccatcatgctggagcatggactctcccatatggtcaaatctttctccaagcaaagtgct
ggcagggttgctggtgggaagaatgttcctgctgcggtacagaaagtggcaaaggcctcc
attgaccaaagcagacagatgaggtaccagtccttgaacgagtacaggaaacgcttcatg
ctgaaaccattccgatccttcgaagagcttacaggagaaaaagagatggcagcggagctg
gaggagctctacggggacattgatgccatggagctgtacccaggcctgctggtggagaag
ccccggcccggggccatctttggcgagaccatggtggaaatgggggcaccattctccctg
aaggggctgatgggcaatgccatctgctcccctgagtactggaagcccagcaccttcggg
ggcaaggtgggctttgacatcgtcaacacagcctccctgcagaagctcatctgcaacaac
gtgaaaggctgtcccttcactgccttccacatcctgcctcctgagcccaccgaggccacg
attaatgttagtacctcaaaaactgccatggaagatatcaaccccacgcttctgctgaaa
gagcgctctgccgagctgtag

DBGET integrated database retrieval system