KEGG   Parus major (Great Tit): 107208647Help
Entry
107208647         CDS       T04864                                 

Gene name
NEU2
Definition
(RefSeq) sialidase-2 isoform X2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00511  Other glycan degradation
pmaj00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107208647 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107208647 (NEU2)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     107208647 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR BNR_4
Motif
Other DBs
NCBI-GeneID: 107208647
NCBI-ProteinID: XP_015492668
LinkDB All DBs
Position
9
AA seq 412 aa AA seqDB search
MSLRAQRGLRVILVQSQTRRSEEPGNQKEIPGTMAAFPVLEQETLFQNGTWSYRIPALLY
LPRFSMILAFAEEREDLVDEHAKLIAMRRGVYDPATQHVQWKRMETLVSAQLEDHRSMNP
CPVYDEVSGKLILFFIAVPGKISEQHQLRTKINLVRLCYVTSMDQGRTWSTAQDVTDRTI
RNEYKNWATFAVGPGHGLQLLNEARSLVIPAYAYRILDPKQHPTPHAFCFISSDHGTTWE
KGNFVGEESAVECQVAEVHSCGRKVLYCNARSNRGARIQAVSYNHGLDFEGGQRVETLIE
PPSGCHGSVTAFPPPPDARCQDSWLLYAHPTDPRGRKDLGIYLNKNPLNPGHWTKPSILF
KGLCAYSDLQYMGTGPDGSPLFSCLFEYGTHRQCEEIIFVMFTLKQAFPSEH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgagggctcagagagggctgcgtgtgatccttgtccagtcccagaccaggagg
tcagaagaaccaggaaaccaaaaggaaataccaggcacaatggctgcgttccctgtcttg
gagcaagaaacattattccagaatggtacctggagctatcgaattccagccctgctctac
ctgccacgtttcagcatgatcctggcctttgctgaggaacgagaggacctggtggatgaa
catgccaagctgatagccatgcgcagaggcgtgtatgacccagccacgcagcacgttcag
tggaaaaggatggagacccttgtcagtgcacagctggaggaccaccgatctatgaatcct
tgcccggtatatgatgaggtctcaggaaaactcatcttgttcttcatagctgttccagga
aagatctcggagcagcatcagctgaggacaaagatcaacctggtacgtctctgctatgtc
actagcatggaccaaggacgcacctggagcactgcccaggatgtcaccgacaggaccatt
aggaatgagtacaagaactgggccacgtttgcagtggggccaggtcatggattacaattg
ctcaacgaggcccggagccttgtgattcctgcctatgcctatcgtatcttggatcccaag
caacaccccacccctcatgccttctgcttcatcagctctgaccatgggacaacatgggag
aaggggaactttgtgggggaggagagtgcggtggagtgccaggtggcagaggtgcatagc
tgtggcagaaaggtcctctactgcaatgcaaggagcaacaggggagccaggatccaggct
gtcagctacaaccatgggctggactttgagggaggccagagggttgaaacgctaatagaa
cctccctctggatgccatggaagtgttactgcctttccaccacccccagatgccagatgt
caagacagttggttactctatgctcatcctacagacccaaggggtcgaaaagatttagga
atttacctcaacaaaaaccctttaaatccaggacactggacaaaacccagcatactcttc
aagggcctgtgtgcttattcagatctgcagtatatgggcactgggcctgatggctcccct
ttgttctcatgcctctttgaatatgggacccacagacaatgtgaagagattatttttgtc
atgttcaccttgaagcaagcttttccctcagaacactga

DBGET integrated database retrieval system