KEGG   Parus major (Great Tit): 107208675Help
Entry
107208675         CDS       T04864                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme isoform X1
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00071  Fatty acid degradation
pmaj00280  Valine, leucine and isoleucine degradation
pmaj00310  Lysine degradation
pmaj00380  Tryptophan metabolism
pmaj00410  beta-Alanine metabolism
pmaj00640  Propanoate metabolism
pmaj00650  Butanoate metabolism
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
pmaj01212  Fatty acid metabolism
pmaj03320  PPAR signaling pathway
pmaj04146  Peroxisome
Module
pmaj_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pmaj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107208675 (EHHADH)
   00650 Butanoate metabolism
    107208675 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107208675 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107208675 (EHHADH)
   00310 Lysine degradation
    107208675 (EHHADH)
   00380 Tryptophan metabolism
    107208675 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107208675 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107208675 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107208675 (EHHADH)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107208675 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107208675 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     107208675 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 TrkA_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 107208675
NCBI-ProteinID: XP_015492797
LinkDB All DBs
Position
9
AA seq 760 aa AA seqDB search
MAHYERGSAVAIIRLRNPPPLGDFGIAVAWLITDAQTELKEQQALGAACECSSNSSNHSL
AVLQALEDGLKKADADPSVKAVMICGENGKFSAGADIRGFSSPKRHGVALGPIVALIESI
EKPVVAAIEGVALGGGLEVALGCHYRVAHVKARMGLPEVTIGLLPGAEGTQRLPRLIGVP
AALDMITTGKHIPATEALKLGLVDEIVEENTIEAAIRLANKVIGQPLAPRRLSLKPVPRL
PNMEAFLREALVKVKKQARGCLAPELCFQAVRAATERPFAEGVRRERELFGVLRTSGQAQ
ALQYAFFAERAVHRWATPSGASWSSAAPQPVRQAAVIGLGTMGQGIVTSLVKANIPVVAL
EQNLEYLNKGRKAVMLLLEREAMKMEGGAQTLDFHNPARLQFTVDFDLMRDVDLVIEAVF
ENMALKKEIFHKLSKICKPGALLCTNTSALNIDEIASATSRPQQVIGTHFFSPAHVMRLL
EIIYGRHTSPTAIATAMQLAKALKKVGVVVGNCFGFVGNRMMFPYVQQAVFLLEEGSTPE
AVDQVLEDFGFKIGPFRMSDLAGLDVGWRSRKDLGLTGPSLAAGTPARQRHGQRYSPLPD
LLCEQGRFGQKTGKGWYQYEKAGGRTATPDPWLHNFLSQYRDTHHIKTRFIDQEEILERC
LFSLINEGFAILAEGIASGPEHLDVIYINGYGWPKHRGGPMFYASTMGLPRVLAKLQKYS
EAHPDVPGLRPSAFLKKLVAVGNPPLKEWMSYLSRQSPKL
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactacgagaggggctcggccgtggccatcatccggctccgcaacccgccgccc
ctgggtgattttggtattgctgtggcctggctcatcactgatgcacaaacagaactcaaa
gagcagcaagcattgggtgcagcctgtgagtgctcctcaaatagcagcaaccacagtctg
gcagttctccaggctttagaggatgggctgaagaaagcagatgcagatccctcagtgaaa
gctgttatgatttgtggtgaaaatgggaaattcagtgcaggagctgacatccgaggattt
tcctctccgaagagacatggagttgccctgggccccatcgtggctctcatcgaaagcatt
gagaagccggtggtggcggccatcgaaggcgtcgctttgggaggaggcctggaggtggcg
ctgggctgtcactaccgcgttgcacacgtgaaggctcggatgggattgccagaggtcacc
atagggttacttccaggtgctgaaggcacccagcgactccccagactgattggagtacca
gctgctctggatatgatcactacaggaaaacacattccagcaactgaagcactgaagctg
ggcttggttgatgaaattgtggaagaaaacaccattgaggcagcaatccgtttggcaaac
aaagtgattggtcagcccctggcaccccgcaggctcagccttaagccagttcccagactg
cccaacatggaagcgtttctgcgggaggctctcgtgaaggtgaagaaacaggcgcggggg
tgcctggctccggagctgtgcttccaagccgtgcgagccgccaccgagaggccctttgcc
gagggggtgcggcgggagcgggagctgttcggggtgctgcggacctcggggcaggcccag
gcgctgcagtacgccttcttcgccgagagagccgtgcacaggtgggcaactcccagcgga
gcctcctggagcagcgctgccccgcagcccgtgcgccaggcagccgtcatagggctgggg
acaatgggccaaggcattgtgacttctctggttaaggccaacatacctgtggtagccctg
gagcagaatctggagtatctgaacaagggaagaaaagctgtgatgctccttttggaacgg
gaggctatgaaaatggaggggggtgcccagaccctggatttccataaccctgcacgtctc
cagttcactgtggactttgatctgatgcgtgatgtagacctcgtcatcgaggctgtgttt
gagaacatggcactaaagaaggaaatattccacaagctgtcaaagatctgcaagccggga
gccttactgtgcacaaacacatcagccctgaacatcgacgaaatagcttctgccacgagc
cgcccacagcaggtcattggcacccacttcttctcccctgcccatgtgatgaggctgctg
gaaatcatctatggccgccacacgtcccccactgccatcgccactgctatgcagctggcc
aaagccctgaaaaaagttggagtggtggtagggaactgttttgggtttgttgggaatcgc
atgatgtttccatacgtacagcaagcagttttccttttagaggaaggaagcacaccagaa
gcagtagatcaggttcttgaagattttgggtttaagataggccctttccgcatgtctgac
cttgctgggctggatgtgggctggaggtctcggaaggacctgggcctgactgggccgtcc
ctcgctgcaggcacaccggcccggcagcggcacggccagcgctacagccccctgccagac
ctcctgtgtgagcagggccgcttcggccagaaaaccggcaaaggctggtaccagtacgag
aaggctgggggcaggacagccacgccagacccatggctccacaacttcctgtcccagtac
agagatacccatcacatcaagacccgctttatagaccaggaggaaatcctggagcggtgt
ctgttttccctcatcaacgaggggtttgccatcctggctgagggaatagcatcaggccca
gagcacctggacgtcatttacatcaatggctacgggtggccgaagcacaggggtggcccc
atgttctacgcctccaccatggggcttccccgcgtgctggctaaactgcagaagtactct
gaggcccaccctgatgtgcctgggctacggcccagtgcctttctgaaaaagctggtggct
gtggggaatccccccctcaaggagtggatgtcctacctcagtcggcagagccccaagctg
tga

DBGET integrated database retrieval system