KEGG   Parus major (Great Tit): 107209164Help
Entry
107209164         CDS       T04864                                 

Definition
(RefSeq) actin, cytoplasmic type 5
  KO
K05692  actin beta/gamma 1
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04145  Phagosome
pmaj04210  Apoptosis
pmaj04510  Focal adhesion
pmaj04520  Adherens junction
pmaj04530  Tight junction
pmaj04810  Regulation of actin cytoskeleton
pmaj05132  Salmonella infection
pmaj05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107209164
  09143 Cell growth and death
   04210 Apoptosis
    107209164
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107209164
   04520 Adherens junction
    107209164
   04530 Tight junction
    107209164
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107209164
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107209164
  09172 Infectious disease: viral
   05164 Influenza A
    107209164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmaj03021]
    107209164
   03019 Messenger RNA biogenesis [BR:pmaj03019]
    107209164
   03036 Chromosome and associated proteins [BR:pmaj03036]
    107209164
   03029 Mitochondrial biogenesis [BR:pmaj03029]
    107209164
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pmaj04812]
    107209164
   04147 Exosome [BR:pmaj04147]
    107209164
Transcription machinery [BR:pmaj03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107209164
Messenger RNA biogenesis [BR:pmaj03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107209164
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     107209164
    NuA4 complex
     107209164
  Chromatin remodeling factors
   BAF complex
    107209164
   PBAF complex
    107209164
   SWR1 complex
    107209164
Mitochondrial biogenesis [BR:pmaj03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    107209164
Cytoskeleton proteins [BR:pmaj04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107209164
Exosome [BR:pmaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   107209164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 107209164
NCBI-ProteinID: XP_015493946
LinkDB All DBs
Position
10
AA seq 376 aa AA seqDB search
MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS
YELPDGQVITIGNERFRCPESIFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggagatcgctgccctggtggtggacaacggctcggggatgtgcaaggcg
ggtttcgcgggcgacgacgcgccccgcgccgtcttcccctccattgtgggacggccgcgg
caccagggcgtcatggtgggcatggggcagaaggacagctacgtgggggacgaggcgcag
agcaagaggggcatcctcaccctcaagtaccccatcgagcacggcatcgtcaccaactgg
gacgacatggagaagatctggcaccacaccttttacaacgagctgcgcgtggcgcccgag
gagcacccggtgctgctcaccgaggctcccctcaaccctaaagccaaccgggagaagatg
acacagatcatgttcgagaccttcaacaccccggccatgtacgtggccatccaggccgtg
ctgtccctctacgcctcgggccgcaccacgggcatcgtgatggactccggggacggcgtc
acccacaccgtgcccatctacgagggttacgctctgccccacgccatcctgcgcctggac
ctggccggccgtgacctcaccgactacctcatgaagatcctgacagagaggggctacagc
ttcaccaccacggccgagcgcgagatcgtgcgcgacatcaaggagaagctgtgctacgtg
gcgctggacttcgagcaggagatggccacggccgcctcctcctcctcgctggagaagagc
tacgagctgcccgacgggcaggtgatcaccatcggcaacgagaggttccgctgccccgag
tccatcttccagccctccttcctgggcatggagtcgtgcggcatccacgagaccaccttc
aactccatcatgaagtgcgacgtggacatcaggaaggacctgtacgccaacaccgtgctc
tcggggggcaccaccatgtacccgggcatcgccgaccgcatgcagaaggagatcacggcg
ctggcgcccagcaccatgaagatcaagatcatcgccccgcccgagcgcaagtactcggtg
tggatcggcggctccatcctggcgtccctctccaccttccagcagatgtggatcagcaag
caggagtacgacgagtccggcccctccatcgtgcatcgcaagtgcttctag

DBGET integrated database retrieval system