KEGG   Parus major (Great Tit): 107210374
Entry
107210374         CDS       T04864                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pmaj  Parus major (Great Tit)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 107210374
NCBI-ProteinID: XP_015496619
LinkDB
Position
12
AA seq 518 aa
MGGLFLRRAWPCRGTGVGSSTAVPWDTVAPSGWMRGERGTVRRVGFRCLARAPQGPSGLK
LLPALGLPEQTLRAASQLTPSCRDPRRVRQYLHAVGWTCMCRGWNPSVPWGHVQRCVAAP
RKYSLVVAGTPSRDARSPVCGASTLKWGAGGKGGLHPQPGPPASNLRASPRGQSLPRRPG
AGLAAAGALPWGRLSDLGCREGTLGSGCPRSAFTRPCSPRDGRLGGGRCRCPRSRAGAAV
SSAVRPGTAQLSASRADATPRNRPRICRGCGVGWGPPGHRGRRDGTSRSQCRSAWLLFTQ
DEPSEWEKTELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPAT
KRVPSLQAGRPHPQGVKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKFTVIDNPRKF
ALFERSEKDEQVYLRKLSDDEQPLRLRLLAGPSEKVLSFILKENETGEVNWDAFTLPELH
NFLLILQREEEEHVRRLRHRYARCRQKMQEALATRTPG
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgggtggtcttttcttgaggcgagcttggccctgccgtggtacaggagtggggtcaagc
acggccgtgccgtgggacacggtggccccgtccggttggatgcggggtgagcgaggcacc
gtgaggcgagtggggtttcgttgcttggcacgggcaccccaaggtccctcagggctgaag
ctgctcccagctttggggttgccggaacaaactctccgggcagcttcacagctgacccca
tcgtgcagggaccctcgcagggtccggcagtacctgcatgctgtggggtggacatgcatg
tgtcggggctggaacccctcggtgccatggggacacgtgcagcgctgtgtggcagctccg
cgtaaatactcattagtggtggcagggacgccgagccgggacgctcggtcccccgtgtgc
ggggccagcactttgaagtggggtgccggcggcaagggcgggctgcacccccagcccggc
cctcctgcctcaaatctcagggcgtccccgcgggggcagagcctgcccagacgccctggt
gccggcctggcggctgccggcgctctgccttggggacgcctctctgatctggggtgccgg
gaggggacgctcggctccgggtgtcctcgcagtgcgttcacacggccctgcagccccagg
gacgggcgcctggggggcggccggtgccggtgtccccggagcagggccggggcggcggtg
agctcagctgtgcgtcccggcacagcacagctcagcgccagccgggctgatgcaaccccg
cgcaaccgcccgcgcatctgccggggctgcggggtgggctgggggccgccgggacaccga
ggcaggcgggacggtacctcccgatctcagtgccgctcagcctggctgctgttcacgcag
gatgagcccagcgagtgggagaagacagagctggaccaggcgcaggtggagcagcggatc
aaggagtacaacagccagatcaacagcaacctcttcatgagcctgaacaaggacggctcc
tacaccggcttcatcaaggtgcagctgaagctggttcgccctgtctccgtgccggccacc
aagcgggtcccctccctgcaggcggggcgaccgcacccccagggggtgaagcgccgcacg
tccttctacctgcccaaggggaccgtcaagcacctgcacatcctttcgcacacccgcgcc
agcgaggtcattgacgccctcctccgcaagttcaccgtcatcgacaacccccgaaagttc
gccctcttcgagaggtctgagaaggatgagcaagtgtacctgcggaagctgagtgacgac
gagcagcccctgcggctgcggctgctggccggccctagcgagaaggtgctgagtttcatc
ctgaaggagaacgagaccggagaggtgaactgggacgccttcacgctgccggagctgcac
aacttcctgctgatcctgcagcgggaggaggaggagcacgtgcggcggctgcggcaccgc
tacgcgcgctgccgccagaagatgcaggaggcgctggccacgcgcacgccagggtga

DBGET integrated database retrieval system