KEGG   Parus major (Great Tit): 107210533Help
Entry
107210533         CDS       T04864                                 

Definition
(RefSeq) leukotriene C4 synthase-like
  KO
K00807  leukotriene-C4 synthase [EC:4.4.1.20]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00590  Arachidonic acid metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    107210533
Enzymes [BR:pmaj01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.20  leukotriene-C4 synthase
     107210533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 107210533
NCBI-ProteinID: XP_015496953
LinkDB All DBs
Position
13
AA seq 145 aa AA seqDB search
MLDQIHWLAAVTVLGVLEQAYFFLQVIYARRLFGVSPPKISGPPEFERIFRAQVNSSEYF
PIFLALLWQAGLFFHQGLAAALGLLYLYARYCYFKGYKASSSERLAPIYFSAGVLWILIA
VSALGILHFFLSHYVGLNVLQRLRA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcagattcattggctggctgctgtgacagtcctgggagtcctggagcaagcc
tacttcttcctccaggtgatctatgctaggaggttgtttggtgtttcacctccaaagatc
tcaggccctcctgaatttgaaaggatctttcgagcacaggtgaactcctctgagtatttt
cccatcttcctggcacttctgtggcaggctggactcttcttccatcaaggtctggctgca
gccttgggtctgctctatctctacgctcgatactgctactttaagggatacaaggcatcg
tcctcagaaagactcgccccgatatacttcagtgctggagtcctctggattctcattgca
gtgtcagccctgggcatcctgcatttcttcctctctcactatgtggggctgaatgtcctc
cagcgtctgagagcatga

DBGET integrated database retrieval system