KEGG   Parus major (Great Tit): 107210662
Entry
107210662         CDS       T04864                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107210662 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107210662 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmaj04052]
    107210662 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pmaj00536]
    107210662 (FGF1)
Cytokines and growth factors [BR:pmaj04052]
 Growth factors
  Growth factors (RTK binding)
   107210662 (FGF1)
Glycosaminoglycan binding proteins [BR:pmaj00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107210662 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107210662
NCBI-ProteinID: XP_015497204
LinkDB
Position
13
AA seq 155 aa
MAEGEISTFSALTEKFNLPSGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGVVHIRSTQSGQYLAMDTNGLLYGSQLLGEECLFLERLEENHYNTYVSKLHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggaaatctccaccttcagcgccctgacggaaaaattcaacctcccctcg
ggcaactacaagaaacccaagctgctgtactgcagcaacggggggcatttcctgcgcatc
ctcccggacggcaccgtggatggcaccagggaccgcagcgaccagcacattcagctgcag
ctgagcgcggagagcgtgggggtggtgcacatcaggagcacgcagtcggggcagtacctg
gccatggacaccaacgggctgctctacggctcgcagttactgggtgaggagtgtctgttc
ctggaaaggctcgaagaaaaccattacaacacctacgtctccaaactgcacgcggacaag
aactggtttgtggggctgaagaagaacgggaacagcaagctgggcccgcggactcactac
ggccagaaggcgatcctcttcctgccactgcccgtctcagccgactga

DBGET integrated database retrieval system