KEGG   Parus major (Great Tit): 107210791
Entry
107210791         CDS       T04864                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107210791 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmaj03000]
    107210791 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pmaj03310]
    107210791 (NR3C1)
Transcription factors [BR:pmaj03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107210791 (NR3C1)
Nuclear receptors [BR:pmaj03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107210791 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 Gemini_AL2
Other DBs
NCBI-GeneID: 107210791
NCBI-ProteinID: XP_015497563
LinkDB
Position
13
AA seq 773 aa
MDSKELLNPSDRDETRKNALISTKGGIVMDFHPPFRGGATVQAPVSTSPLPAPSQSDSSQ
QPALADFPKGLGNNVPQPDLSKAVSLSMGLYMGETDAKVMGNDLGFSHQGQIHISSGETD
FRLLEESIASLNKSSSLAEDAKGTASSEVPLEPDFPGMAGRSVPAESGAAVQSQVGSNGG
NLKLFSEDQSTLDILQDLELPPVSPGKEPNGSPWRLDPLLDDGGLLSPISADDAFLLEGS
LGEDCKPPLLSDTKPKINDRGDLLPSSKMPVPQVKTEKEDFIELCTPGIKQENMGPLYCQ
ANFSGSNLLGTKVSAISIHGVSTSGGQMYHYDLNTASLSQQQDQKPIFNIIPSLPAGSEN
WNRCQGSGDEALAPLGTLNLSGRPAFSNGYSSPGMRSDVSSSPSTTSATTGPPPKLCLVC
SDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQA
GMNLEARKTKKKIKGLQQGGAAGAREAAEAAGSKSIVPASLPQLTPTLVSLLEVIEPEVL
YSGYDSSLPDSSWRILSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLM
AFALGWRSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSYEEYL
CMKTLLLLSTIPKEGLKSQSLFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDS
MHDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggattccaaagaattgcttaacccgtcggatcgggacgaaaccaggaaaaatgcactc
atcagtaccaaaggagggatcgtgatggacttccatccacccttcaggggtggagctact
gtccaagcccctgtgtctacatctcctctccctgcaccttctcagtcggattccagtcag
caacctgctttggctgactttccaaaaggattaggaaacaatgtgcctcagccagacctt
tccaaggcagtgtcgctctcgatgggactgtacatgggtgaaacagacgcaaaagtgatg
ggaaacgaccttggattttcgcaccagggccaaatccacatctcttctggagaaacggac
ttcaggctcctggaggaaagcattgcgagcttgaacaagtcctcgagcctggccgaggac
gcgaagggaaccgcgtcttctgaggtgccgctcgagccggatttcccaggcatggccggg
cgcagcgtccccgcggagtcgggagctgcagtccaaagccaggtgggctcgaatggtggc
aacttgaagttgttctctgaagaccaaagcaccctggatatcctccaggatctggaattg
ccgccggtgtcgccgggcaaggagcccaacgggagcccgtggcggctggacccgttgctc
gatgacggtggcttgctctcccccatatccgcggacgacgcctttctcctggaaggaagt
ctcggcgaagactgcaagcctcctcttttatctgacactaaacctaaaattaatgaccgt
ggtgaccttttacccagttccaaaatgccagtgccacaagtgaaaacagaaaaggaagac
ttcattgaactgtgtactcctggcatcaagcaggaaaacatgggcccgctttactgccag
gccaacttctccgggtcgaacctgctgggtacgaaagtctcggccatctccatccacggt
gtcagcacctctgggggacagatgtaccactatgatttaaatactgcgtcgctctctcag
cagcaggatcagaaaccaatttttaatatcattccatctcttcctgccgggtcagaaaat
tggaataggtgccagggatcgggggacgaggcattggctccgctgggaacgctcaacctc
tctggcagacctgctttctctaatggctattcaagccctggaatgaggtcagatgtaagc
tcttctccatccacaacctcagcaacgacgggaccacctcccaagctctgcctggtgtgc
tctgacgaggcctccgggtgccactacggtgtcctgacgtgtggcagctgcaaagtgttc
ttcaagcgggcagtggaaggacagcacaattacctgtgtgccggcaggaacgactgcatc
atcgacaagatccgcaggaagaactgccccgcgtgccgctaccgcaagtgtctgcaggcg
ggcatgaacctggaagctcggaagacgaagaagaagatcaaggggctgcagcagggcggc
gcggcgggcgcgcgcgaggctgcggaggcggcgggcagcaagagcatcgtgcccgcgtcg
ctgccgcagctgacgcccaccctggtgtccctgctcgaggtgatcgagcccgaggtgctc
tactccggctacgacagctccctgcccgactccagctggaggatcctctccacgctcaac
atgctgggcggccgccaggtggtcgctgcggtcaagtgggcgaaggcgatcccaggtttc
cgaaatttgcacctggatgaccaaatgacccttctgcagtactcctggatgttcctgatg
gcttttgctttgggctggagatcctacaagcagtccaatggcaacctgctgtgctttgct
ccagacctgatcattaacgagcagaggatgaatctcccgtgtatgtatgaacaatgcaaa
cacatgctcatggtggcccgagagctgtcccggctccaagtctcctacgaggagtatctc
tgcatgaagacgttgcttctcctctctacaattcccaaggaaggcctgaagagccagtcc
ctgtttgaggagatccgcatgacgtacatcaaggagctgggcaaggccatcgtcaagagg
gaagggaactccagccagaactggcagcgattttatcaactgactaaactgctggactct
atgcatgatgtggttgaaaatcttctgagcttttgcttccagacatttttggataaatcc
atgagtattgagttcccagaaatgttggcagaaatcatcagcaatcagataccaaaatat
tccaatggaaatatcaagaagctcttgtttcatcagaagtga

DBGET integrated database retrieval system