KEGG   Parus major (Great Tit): 107211160Help
Entry
107211160         CDS       T04864                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj01100  Metabolic pathways
pmaj04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107211160
   00500 Starch and sucrose metabolism
    107211160
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107211160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmaj04147]
    107211160
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107211160
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107211160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107211160
NCBI-ProteinID: XP_015498300
LinkDB All DBs
Position
14
AA seq 940 aa AA seqDB search
MEPFSEPLHGAGTRTMKSYQKLTTTQPAACRVEEEGAAAVPSNHGKLAPWWVGSGLLVAS
VLLSTITVWVLRQVSGGWLGPTAPPKCLLVPESHRFDCYPERRVVVTQELCESRGCCFIQ
SPPQAQGKQGVPWCFYPPDFPSYTLESLNQTALGMVGLLVRREKAYYPRDIEKLRLDVEF
ETDTRLHIKITDAANPRYEVPFDVPRVMKRAENPIYSLNFSWDPFGVLLQRKATGTVLLN
TTVAPLIFADQFLQISTSLPSKFLYGLGEHRGSLVHSVEWNTLTLWARDVSPTESFNLYG
AHPFYLLMEEGGNAHGVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPSMVIQQ
YQQVIGFPAMPPIWALGFHLCRWGYGSSNETWQTVRAMRNYQIPQDAQWNDIDYMDGYRD
FTLDSQKFSSLPSLVEDLHKHGQHYVMILDPGISSTSPHGSYWPYDEGLRRGLFLNTTQG
QPLIGQVWPGFTAFPDFSNPDTHQWWLENLQHFYAHVPFDGLWIDMNEPSNFMDGSEHGC
PPGEFDSPPYTPAVLGDSLSAKTVCASAKQKVSVHYNLHNLYGLMEAKVTASALIKIRGK
RPFVISRSTFPSQGRYSGHWLGDNRSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGST
SEELCTRWMQLGAFYPFARNHNQNKKAQDPTAFSPAARTAMKDVLLTRYSLLPFLYTLFH
RAHLQGDTVARPLFFEFPWDVATWELDRQFLWGRSLLVTPVLEPGVDSVTGYVPQGTWYD
FYTGSSVNSSGEMLKMSAPLEHLNLHIREGSILPTQKPGTTTEVTRGNPLRLIVALSSHA
TAWGDLFWDDGESLDTFEKGNYSYVVFNVTQNIFTSTILHASTEATKVTIDMLSIFGVQK
PPSKVLLNGQEKTFSYLDNQVLTVSDLGMSLSQGFSLQWL
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggagccgttttctgagcctttgcacggagcaggcaccaggacaatgaagtcgtaccag
aagctgacaacaacacagccagcagcatgccgggtggaagaagaaggggctgctgccgtg
ccctccaaccatgggaagctggccccatggtgggtgggcagtgggctgctggtggcttct
gtcctgctgagcaccatcactgtctgggtgctgcggcaagtatcggggggctggctcgga
cccacagcaccccccaaatgtctcctggtacctgagagccatcgctttgactgctaccca
gagcggcgcgtggtggtgacacaggagctctgtgaaagccgagggtgctgcttcatccag
agtcccccacaagcacagggcaagcagggggtgccctggtgcttctatccccctgacttc
cccagctacaccctggagagcctcaaccagacagcactgggcatggtggggttgctggtg
cgaagggagaaggcctattaccctcgggacatcgagaagctgaggctggatgtggagttt
gagacagacacgcggctgcacatcaagataacagatgcagccaacccacgctatgaggtt
ccctttgatgttccccgggtgatgaagagggcagaaaaccccatctacagtctgaacttc
tcctgggacccctttggggtgctgctgcagcgcaaagcaacagggacggtgctgctaaac
accactgtggcccccttgatctttgctgaccagtttctccagatatccacatctctccca
tccaagttcctctatgggctgggggagcaccgtggcagcctcgtgcacagcgtggagtgg
aacaccctcacactgtgggcccgcgacgtctctcccacggaatcgttcaacctgtatggc
gcccaccccttctacctgctgatggaggagggtggaaatgctcatggtgttttccttctc
aacagcaatgccatggaggtggctctgcagcctgctccaggcctgacctggaggaccatt
ggaggggtgctggatttttacatcttcctggggcctgatcccagcatggtcatccagcag
taccagcaggtgataggtttcccagccatgccacccatctgggctcttggcttccacctc
tgccgctggggctatgggtccagcaatgagacgtggcagaccgtgagagccatgaggaac
taccagatcccccaggatgcacagtggaatgacattgattacatggatgggtaccgggac
ttcaccttggattcccagaagttttcttccctcccctccctggtggaagacttacacaaa
cacgggcagcactacgttatgatcttggatcctggcatcagcagcaccagccctcatggc
tcctactggccttatgatgaaggtttgagacggggcttgttcctcaacaccacacaaggg
cagccactcatcggacaggtctggcctggtttcactgccttcccagacttttccaaccca
gacacacaccagtggtggctggagaacctgcagcacttctatgcccacgtgccctttgat
ggcctctggatcgacatgaatgagccatccaacttcatggatgggtctgaacatggctgc
cccccaggagagttcgacagcccaccctacactccagccgtgctgggcgattccctctct
gcaaagacggtgtgtgcctcggcaaagcagaaagtctcggtgcactacaacctccacaac
ctctatgggctgatggaagccaaagtcacagcaagcgccttgatcaagatccgggggaag
cgtcccttcgtcatctcccgctccacattccccagccagggccggtactcggggcactgg
ctgggtgacaaccggagccagtggaaggacatgtattactcaattccagggctgctgagc
ttcagcctctttggcatcccactggtcggggcagacatctgcggcttctctggcagcacc
tcggaggagctgtgcacccgctggatgcagctcggtgccttctacccctttgctcgcaac
cacaaccagaacaaaaaggcccaggacccaacagcgttcagccccgcagccaggacagcc
atgaaggatgtgctgctgacccgctattccctcctgcccttcctctacacccttttccac
cgtgcccacctgcaaggggacactgtcgcccggcccttgttctttgagttcccttgggat
gtggccacgtgggaactggacaggcagttcctgtggggccggagcctgctggtaacacca
gtgctggagcccggggtggactcagtcacaggttacgtcccccaaggcacgtggtatgac
ttctacacgggctcctcggtgaacagcagtggggagatgttgaagatgtcggcccctctg
gagcacctcaacctgcacatccgggaaggttccatcctgcccacccagaaaccaggaacc
accacagaggtgacccgagggaaccccctgcgtctcatcgtggccttgtcctcgcatgcc
actgcctggggtgaccttttctgggacgatggcgagagcctggacacctttgagaagggc
aattactcctatgtggtgttcaatgtcacacagaacatcttcacctccaccatcctccat
gctagcactgaggccaccaaggtcaccattgacatgctgagcatctttggagtgcagaag
ccgcccagcaaggtcctcctgaatggccaggagaagaccttttcttacctggacaaccag
gttctcacagtgagtgaccttggcatgagcctcagccagggcttctccctgcagtggctg
tga

DBGET integrated database retrieval system