KEGG   Parus major (Great Tit): 107211700Help
Entry
107211700         CDS       T04864                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00010  Glycolysis / Gluconeogenesis
pmaj00053  Ascorbate and aldarate metabolism
pmaj00071  Fatty acid degradation
pmaj00280  Valine, leucine and isoleucine degradation
pmaj00310  Lysine degradation
pmaj00330  Arginine and proline metabolism
pmaj00340  Histidine metabolism
pmaj00380  Tryptophan metabolism
pmaj00410  beta-Alanine metabolism
pmaj00561  Glycerolipid metabolism
pmaj00620  Pyruvate metabolism
pmaj01100  Metabolic pathways
Module
pmaj_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107211700 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    107211700 (ALDH2)
   00620 Pyruvate metabolism
    107211700 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107211700 (ALDH2)
   00561 Glycerolipid metabolism
    107211700 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107211700 (ALDH2)
   00310 Lysine degradation
    107211700 (ALDH2)
   00330 Arginine and proline metabolism
    107211700 (ALDH2)
   00340 Histidine metabolism
    107211700 (ALDH2)
   00380 Tryptophan metabolism
    107211700 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107211700 (ALDH2)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107211700 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 107211700
NCBI-ProteinID: XP_015499536
LinkDB All DBs
Position
15
AA seq 520 aa AA seqDB search
MLRAVLRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAFNKIFINNEWHDAVSKKTFPSI
NPATGEVICQVAEGDKADVDKAVKAAKAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVANLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGQREGAKLLCGGNPAADRGYFIQPTVFGDVQDNMTIAREEI
FGPVMQILKFKTIKEVIERANDSKYGLAAAVFTKDLDKANFVSQSLRAGTVWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggtgctgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgccgcctcccccatcccggcgcccaacccgcgccccgacatcgcctttaac
aagattttcataaataacgaatggcacgatgcagtcagcaagaaaaccttcccttccatc
aacccagccacgggagaagtcatctgccaggtggctgagggcgataaggcagacgtggac
aaggcggtgaaggcagccaaggcagcattccagctgggctctccctggaggaggatggat
gcatctcaccgggggaagctgctgaaccgtctggctgacctgatcgagagggaccgcgcc
tacctggccgccctggaaactctggataatggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtcagataaattccac
ggcaaaaccatcccgttagacggagacttcttctgctacacaagacatgagccggtggga
gtctgtggacaaatcatcccgtggaacttcccgctgttgatgcaagcatggaaactgggg
cctgccctggccactgggaatgtggttgtgatgaaggtggcagagcaaacccccctgagt
gctctctacgtggccaatctgatcaaagaggctggattccccccgggcgtggtgaacatc
atccctggctatggccccacggcaggagctgccatctcctcccacatggacattgacaaa
gtggccttcaccggctccacggaggtcggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatatcatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaagggcag
tgctgctgtgccgggtccaggacctacgtgcaggaggacatttacaacgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttgggaacccctttgacttcaaaactgag
cagggccctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcactggg
cagcgggagggagccaagctgctgtgtggtggcaaccccgctgcagacaggggctacttc
atccagcccactgtctttggggatgtgcaggacaacatgaccattgccagggaggagatc
tttgggccggtcatgcagatcctgaaattcaaaaccatcaaggaggtcattgagagagcc
aacgactccaagtacggcctggcagccgcggtgttcaccaaggacctggacaaagccaac
tttgtgtcgcagagcctgcgggctgggacggtctggataaactgctacgatgtgtttggt
gcccaggctccctttggtggctacaaagcctctgggaacgggcgggagctgggagagtac
ggcctggaggcttatgtggaggtgaaaaacgtgacaatcaaaattccacagaaaaactcc
taa

DBGET integrated database retrieval system