KEGG   Parus major (Great Tit): 107211923Help
Entry
107211923         CDS       T04864                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00590  Arachidonic acid metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107211923 (PTGS1)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107211923 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 107211923
NCBI-ProteinID: XP_015500003
LinkDB All DBs
Position
17
AA seq 598 aa AA seqDB search
ARAPPAAGLRLLLAHAVLLCAAGSAAGTGSVNPCCYFPCQNQGVCVRVGLRGYECDCTRT
GYYGVNCTSPEFWTRLHNLLKPSPAFYHFILTHFKWFWDIINSTFIRDTLMRLVLTVRAN
LIPSPPTFNSDYGYISWEAYANVSYYTRILPPVPDDCPTPMGTKGKLQLPDPQLLAERFL
LRQKFEADPRGTNMMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQH
QLRLFRDGKLKFQVVDGEVYPPMVTEAPVHMVYPSGVPKEQQLAVGQEVFGLLPGLCVYA
TLWLREHNRVCDLLKRDHPTWSDEQLFQTARLILIGETIKMVIEDYVQHLSGYYLSLKFD
PELLFGSQFQYRNRIAVEFNQLYHWHGLMPDSFIIQGQEYSYKQFLYNTSMLMDYGVEAL
VESFSKQVAGRIGGGHTINANVLHVAVGVIKESRQLRLQPFNEYRKRFGLKPYKSFQELT
GEEEKAAELEELYGDIDALEFYLGLLLEKPQPNGIFGESMVEIGAPFSLKGLFGNPICSP
DYWKPSTFGGATGFEIVKTASLKKLVCLNVKKCPYVAFHVPDAAEHGSPRAGGSSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gcccgggcccctccggccgcggggctccggctgctgctcgcccacgccgtgctgctctgc
gccgccgggagcgccgccggcaccggctccgtgaatccctgttgctatttcccctgccag
aaccaaggggtgtgtgtgagggtgggcctgagaggatacgagtgcgactgcacacggacg
ggctactacggggtgaactgcacctcccctgaattctggacacgtctccacaacctcctg
aagcccagtcctgccttctaccacttcatcctgacccacttcaagtggttttgggacatt
atcaacagcaccttcatcagggacacgctcatgaggctcgtgctgacagttcgtgccaat
ctcatccccagcccccccactttcaactctgactatggctacatcagctgggaggcctat
gccaacgtcagctattacacccgcatcctcccacccgtgccggacgactgccccacgccc
atggggaccaaagggaagctgcagctccccgacccccagctcctggcagagaggttcctg
ctgcggcagaagtttgaagctgatccccgaggcaccaacatgatgtttgccttcttcgcc
cagcatttcacccaccagttcttcaagacatctgggaagatgggacgcggcttcaccaag
gcgctggggcacggggtggacctgggacatttgtacggggacaacctgcagcggcagcac
cagctgcgactcttccgagatgggaagctgaaatttcaggtggtggatggagaggtgtac
ccgcccatggtcactgaggctccggttcacatggtgtacccgtcgggagtgcccaaggag
cagcagctggcagtggggcaggaggtgttcgggctgctgccggggctctgcgtgtacgcc
acgctctggctacgcgagcacaaccgcgtctgtgacctgctcaagcgggaccatcccacc
tggagtgacgagcagctcttccagacggcgcggctcatcctcatcggggagaccattaag
atggttattgaagactacgtccagcacctcagtgggtactacctgagcctcaagttcgac
cccgagctgttgttcgggtcacagttccagtaccggaatcgcatcgcagtggagttcaac
cagctctatcactggcacgggctgatgcctgactccttcatcatccagggacaggagtac
agctacaagcagttcctctacaacacctccatgctcatggactacggcgtggaggcgctg
gtggagtccttttccaagcaggtggcaggaaggattggtgggggacacaccatcaatgcc
aatgtcttgcacgtggctgttggggttatcaaggagtcccggcagctgaggctgcagcct
ttcaatgagtatcggaaaaggtttggcctgaagccctacaagtccttccaggagctgaca
ggagaggaagaaaaggcagcagaactggaagagctgtatggagacattgatgctctggag
ttttacctaggcttgctgctcgagaaaccccaacccaacggcatttttggggaaagcatg
gtggagattggagctccattttccctaaaggggctttttggaaatcccatctgctcccca
gactactggaaacccagcacatttggtggagcaaccggctttgagattgttaagacggca
tccctcaagaagctcgtgtgcctcaatgtgaagaagtgcccgtacgtggcgttccacgtg
ccagatgctgcggaacacggcagccctcgggctggtggatcatctacagagctctag

DBGET integrated database retrieval system