KEGG   Parus major (Great Tit): 107211991
Entry
107211991         CDS       T04864                                 

Gene name
GOLGA2
Definition
(RefSeq) golgin subfamily A member 2 isoform X1
  KO
K20358  golgin subfamily A member 2
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmaj04131]
    107211991 (GOLGA2)
Membrane trafficking [BR:pmaj04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107211991 (GOLGA2)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C
Other DBs
NCBI-GeneID: 107211991
NCBI-ProteinID: XP_015500141
LinkDB
Position
17
AA seq 1046 aa
MADGSRQSRLAAAKKKLKEYQQKNSPGATAGTKKKRKTKEGSRPATPTTDDQQPPENIQN
ILKVLVSDLNRSNGVAIPSLDKRKAYFDSDVATRSAEQLAPDVPVLSNSNSLPSCGSVLP
APESMQLTQMNEAEDHKNALDENRSFSSTEGLRQLSEQLNGLVSQSTSYVNGESAVSSTN
IKEMETRYQELAVALDSSNLTNKQLVTKIEELKQQNQEAVNQLEKEKKEFEQKFSKEQAA
LREQLQVHIQTIGILVSEKSELQTALGHTQQAARQKSGEAESLAARLHSSRQRVSELERT
LSSISMQQKQSEKHNKELVKERDNLKLELYKRSKSSEEIKQQNSELSEKVHSLVSQNSAM
KLDVEDLQKKLEMAELMIQQFSSQGGSLDANQQLQMALEERASLETQVAQLSESLHQLQA
ERDQYVEKLREEGSAWQQRVQQLSEQVHTMAEEKEKHMARIQELEDNVTELLSTSAVKPM
DIEPPSLPGPTAAELSLQEEIQRLQQEKEELHGQYQAQVRDNEQLSHLNREQEERLLELE
KAVQRYSEEAVDRQQILEDMQSDKATISRALSQNRDLKEQLAELQNGFVKLTNENMEVTS
ALQSEQHVKKELAKKLGQLQEDLAELKETLELKTQEARGLQEQRDQCYSHLQQYTLAFQQ
LAAEKDELHKQFLLQTQLMDRLQHEEVQGKVTVEMHLKELQQTKESLEAVAKENKELQAQ
ISQLAAEMDGRILHQLEEGDEAMTEEIQKPSLVIPEKFESHEEMVTFVTSAMSQVEQERE
DLRKQLAAQKQQCRTLLQQITALRQEQQHHVTLDAGSIMDTVPVEVHEALKTAMDKLQLR
FTELMREKADLKERLEELEHRCIQLSGETDTIGEYIALYQSQRAILKQRHQEKEEYISRL
AQDKEEMKMKLLELQDLVMRLVRERNEWYSKYVAAAQNPELLVSQTEGVLPAERRIELNA
TDGAGLREVNLSDEAEQEAAVHQSGFPPADSKAAQPNQEDPTAKQIMQLLREIQNPQERL
GSLLENPCIPFFYRADENDEVKIMVV
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggcggacggtagcaggcagagccggttggccgcggccaagaagaagttgaaggaatat
cagcagaagaacagccctggagcaactgcaggaactaagaaaaaacgcaaaactaaagaa
ggcagcagacctgcgactcccaccactgatgaccagcagcctccagagaatattcagaac
attctgaaggtgctggtgtcagaccttaaccgctccaatggggtagccataccctcattg
gacaagaggaaggcatactttgacagtgatgttgccactcgtagtgctgaacagcttgct
cctgatgtccctgtgctatctaacagcaacagcctccctagttgtggttctgttctgcct
gctcctgagagcatgcagctgacacagatgaatgaagccgaagatcataaaaatgctttg
gatgagaacaggtctttctcgtcaacagagggtctccgtcagttgtctgaacaactcaat
ggcctggtttcccagtctacatcatatgtgaatggagaaagtgctgtttcttccacaaat
attaaggaaatggaaacacgttaccaggagctggcagtagccctggattccagcaatcta
actaacaaacagctcgttacaaagatagaggaattgaaacagcagaaccaagaagcagtc
aatcagctggagaaggaaaagaaggagtttgaacagaaattttctaaagagcaagcagca
ctgagggaacagttacaggttcatatccagactattggaattctcgtttctgagaagtct
gagttacagacagcccttggccatactcagcaagctgcacggcagaaatcaggagaagct
gaaagccttgctgcccgtttacattcctcccgccagcgagtctcagagctggagcgcact
ttgtcctccatctccatgcagcaaaagcagtcagagaagcataataaagagttagtgaag
gagcgagacaacctgaaactggaactgtacaaacgaagcaaaagtagtgaggaaataaaa
cagcagaattcagagctgtcagagaaggttcactccctggtgtcccagaactcagctatg
aagttggatgtggaagatttgcagaagaaattggaaatggctgaactgatgattcaacag
ttctcgagccagggagggagtctggatgcaaaccagcagctgcaaatggctctggaggag
agggcaagcctggaaacccaggtagctcagctctcagagtcacttcaccagctgcaggca
gaaagagatcagtatgtggagaaactgagggaggaggggagcgcttggcaacagcgggtg
cagcagctctctgagcaggtccacacaatggcagaggagaaggagaaacacatggccaga
attcaggagctggaagacaatgttacagagctgttgagcacatcagcagtgaagcccatg
gatattgagcctccctcactgccagggcccactgcagctgagctcagtctgcaggaggag
atccagcggctgcagcaggagaaggaggagctgcatgggcagtaccaggcccaggtccgt
gacaacgagcagctgagccacctcaacagggagcaggaggagcggctgctggagctggaa
aaggctgtgcagcgctacagtgaggaggctgtggacaggcagcagatcctggaggacatg
cagagtgacaaggccacaatcagtagggcactgagccagaaccgggatctgaaggagcag
ctggctgagctgcagaatgggtttgtcaaactgacaaatgaaaacatggaggttacaagt
gccctacagtcagagcaacatgtgaagaaagagctggccaagaagcttgggcagctgcag
gaggacctggcagagctcaaagagacgctggagctgaagacacaggaggcccgtggcctg
caggagcagcgggaccagtgctacagccacctgcagcagtacaccctggccttccagcag
ctcgctgccgagaaggatgagctgcacaagcagttcctgcttcagacacagctcatggat
cgcctgcagcacgaggaggtccaggggaaggtgacagtggaaatgcacctgaaagagctg
cagcagacgaaggaaagcctagaagctgtagccaaggaaaacaaagagctgcaggcccag
atcagtcagctggcagcagaaatggatggcaggattttgcaccaactggaagaaggcgat
gaagcaatgactgaagaaatccaaaaaccttctcttgtgatcccagagaagtttgaaagc
catgaagaaatggtcacatttgtgacctctgccatgtcccaagtggagcaggaacgagaa
gatctgaggaagcagctggctgctcagaagcagcaatgcagaaccctcctgcagcaaatc
acagctcttaggcaggagcagcaacatcacgtcactctggatgcaggctccattatggat
actgttccagtggaggttcatgaggctttgaaaactgccatggacaagctacagctgcgt
ttcacagagctgatgcgtgagaaggcagatctgaaggagcgtctggaggagctggagcac
cgctgcatccagctgtctggagagactgacaccattggggagtacattgcactgtaccag
agtcaaagggctatcctcaaacagcggcaccaggagaaagaagagtatatcagcaggttg
gcccaggacaaggaagagatgaagatgaaactactggaactgcaggacttagtgatgcgc
ctggtcagagaaagaaatgaatggtacagcaagtatgtagcagctgctcagaacccagag
ttgttggtgagccagactgaaggtgtgcttccagcagaaaggcgcattgagctgaatgcc
actgatggagcagggttacgagaggtgaatctgtcagatgaagcagaacaagaggctgct
gttcatcaatccggtttcccccctgctgacagcaaagctgctcagccaaaccaagaggac
cccacagcaaagcaaataatgcagcttctcagagaaatccagaaccctcaggagaggctg
ggctccctgctggaaaacccatgcattcccttcttctaccgtgctgatgagaacgatgag
gtcaaaatcatggtagtttaa

DBGET integrated database retrieval system