KEGG   Parus major (Great Tit): 107212272Help
Entry
107212272         CDS       T04864                                 

Definition
(RefSeq) protein ADP-ribosylarginine hydrolase-like
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107212272
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     107212272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 107212272
NCBI-ProteinID: XP_015500808
LinkDB All DBs
Position
18
AA seq 358 aa AA seqDB search
MEETVPSVECYEAAMVLSGVGDALGYRGARWEYCTSGPQIHAELAQLGGLAAINLEPPEW
PVSDDTVLHLATAEGLATGLEGEPLLQELARRYVAAMGDMEGRKPGPSSILGTSQLRPGE
PEGYRIPFNPRGTGCGAAMRSLAIGLRYPHASELPTLIRVSIESGRMTHHHPTGYLGALA
VALFGALGARGEPPERWGAELLRVLPLAWDYVEGTGVAVEENAAAWPFFGEAWHRYLDSR
GLLEGRGPPRVPSLPSPAERDTEYLGWALEGWPGRSGHDAPMVALEALLAAGGSWEELCA
RAVLHGGDSDSTGTIAAGCWGLRGGLLSVPPGLHCRLEYRGRLSHAAHRLHELAWGTP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaggagacggtgccctcggtggagtgctacgaggcggccatggtgctgagcggggtg
ggggacgcgctggggtaccggggggcccgctgggagtactgcacctcgggcccccagatc
cacgccgagctggcccagctgggtgggctggcagccatcaacctggagccccccgagtgg
cccgtcagcgatgacaccgtcctgcaccttgccaccgccgaggggctggccacaggcctg
gagggggaacccctcctgcaggagctggctcgccgctacgtggccgccatgggggacatg
gagggacgcaagccgggacccagcagcatcctaggcacctcccagctgcggccaggggag
cccgagggctatcgcatccccttcaacccccgcggcaccggctgcggggccgccatgcgc
agcctggccatcggcctcaggtacccgcacgcctcagagctgccaactctgatccgggtg
agcatcgagagcgggcgcatgacgcaccaccaccccactgggtaccttggagcactggca
gtggccctctttggggcactgggggctcggggagagcccccagagcgctggggggctgag
ctgctgcgagtactgcccctggcatgggactatgtggagggcactggagtggctgtggag
gaaaatgctgctgcctggccattctttggggaggcgtggcaccggtacctggactcccgt
gggctcctggaaggccgtggcccaccgcgggtgccatccctcccatccccagccgagcgg
gacacggagtacctgggctgggcactggaggggtggccagggcgcagcggccacgacgca
cccatggtggccttggaggcgctgctggcggccggcgggagctgggaagagctgtgtgcc
agggcggtgctgcacggcggggacagcgattccacggggaccattgctgctggctgctgg
gggctgcggggagggctgctgtccgtccccccggggctgcactgccgcctggagtaccgc
ggccggctgagccacgctgcccaccggctccacgagctggcctgggggacaccgtga

DBGET integrated database retrieval system