KEGG   Parus major (Great Tit): 107212383Help
Entry
107212383         CDS       T04864                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj01100  Metabolic pathways
pmaj04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107212383 (GAA)
   00500 Starch and sucrose metabolism
    107212383 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107212383 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmaj04147]
    107212383 (GAA)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107212383 (GAA)
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107212383 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 107212383
NCBI-ProteinID: XP_015501013
LinkDB All DBs
Position
18
AA seq 878 aa AA seqDB search
MGPGPALLALLALLGPAEARGAAAAACEVAPSGRFDCGPERLLSRAGCEARGCCYIPGPG
PRSGPGPPWCFFPRGYRSYRAENLTATESGFSARLRRVAAAFLPAAVDDVRLELALETPA
RLRFTLRDAARPRYEVPLATPRVRGRAPATLYGLRVSQEPFGLVVCRQRGGTVLLNTTVA
PLFFTDQFLQISTSLPSRFISGLGEHLTPLFLDTAWTRVTLWNRDMAPAPHVNLYGSHPF
YLVMEDDGSAHGVFLLNSNAMDVLLQPSPALTWRTTGGILDFYIFLGPDPKSVVRQYLDV
VGFPFMPPYWGLGFHLCRWGYSSTAITRQVVANMTAARFPLDVQWNDLDYADAKRDFTFN
KKSFKDYPEMVRDFHSRGLRYIMIVDAGISSSGPPGTYKPYDEGLKRGVFIRNATGQPLI
GKVWPGPTAFPDFTNPATHEWWHDMVKDFHEQVPFDGMWLDMNEPSNFVEGSQHGCPNNN
LEHPPYVPGVFGGRLQAGTICASSQHYLSSHYNLHSLYGLTEAIASHHALLRVRGKRPFI
ISRSTFAGHGRYAGHWTGDVGSDWEQLYYSIPEVLLFNLFGVPLVGADICGFRGDTSEEL
CVRWTQLGAFYPFMRNHNDHGTRPQEPYTFSPAAQAAMRNALRLRYSLLPFLYTLFHRAH
TAGETVARPLFLEFPTDPNSWAVDRQLLWGGGLLVTPVLEAGQTKVSGYFPAGTWYSLAG
DSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPALSTAQSRSKGMALVVALTLDGFAR
GDLFWDDGESWDTFERGDYTEILFLASNDAVLSQLLRASPHLDGVLLEAVTVLGVTSPPR
RVLANGAIVSDFSYRSDTQVLRVPVSLPMWEQFVISWS
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggcccggcgctgctggcgctgctggcgctgctgggcccggccgaggcgcgg
ggcgcggccgctgccgcctgtgaggtggccccgagcggccgcttcgactgcggccccgag
cggctcctgtcgcgggcgggctgcgaggctcggggctgctgctacatccccgggcccggg
ccccgcagcggccccggcccgccctggtgcttcttcccccgcggctaccgcagctaccgc
gccgagaacctgacggccaccgagagcggcttctccgcccggctgcgccgcgtggccgcc
gctttcctgccggcagcggtggacgatgttcggctggagctggcgctggagaccccggcc
cgcctgcgcttcacgctccgggacgcggcccggccgcgctacgaggtgcccctggccacg
ccgcgggtgcgcggccgagcccccgccacgctctacgggctgcgggtcagccaggagccc
ttcggcctcgtggtgtgccggcagcgcggcgggacggtgctgctgaacaccacggtcgca
cccctgttcttcacagaccagttcctgcagatctccacctccctgccctcccgtttcatt
tcggggctgggggaacacctgacaccgctgttccttgacacagcctggaccagggtcacc
ctctggaatcgggacatggcacccgcgccccacgtcaacctctacggctcccaccctttc
tacttggtgatggaggacgatggttcagcccacggtgtctttctgctgaacagcaacgcg
atggacgtgctcctgcagcccagcccggccctgacctggcgcaccacaggtgggatcctg
gacttctacatcttcctgggccccgaccccaagagcgtggtgcggcagtacctggatgtg
gttgggttccccttcatgcccccgtactggggcctgggcttccacctctgccgctggggc
tactcctccactgccatcacccggcaggtcgtggccaacatgacagcagctcgcttcccc
ctggatgtgcagtggaacgacctggattacgcagatgccaagagggatttcaccttcaac
aagaaaagctttaaggactacccggagatggtgcgggacttccacagccgcgggctgagg
tacatcatgatcgtggatgctggcatcagcagctcggggccccctggcacctacaagccg
tacgacgagggcctgaagcggggggtgttcatccggaacgccacggggcagcccctgatc
gggaaggtctggccgggccccacggccttcccggacttcaccaacccagccactcacgag
tggtggcacgacatggtgaaggacttccatgaacaagtgcccttcgatggcatgtggctt
gacatgaacgagccctcaaacttcgtggagggctcccagcacggctgccccaacaacaac
ctggagcatcccccctacgtgccgggtgtgtttgggggacgcctgcaggccgggaccatc
tgtgcctccagccagcactacctgtcctctcactacaacctgcacagcctgtacgggctg
accgaggccatcgcctcccaccatgctctgctgagggtccggggcaagcgtcccttcatc
atctcccgctccaccttcgctgggcacggccgctacgccgggcactggacaggagacgtt
ggcagcgactgggagcagctctactactccataccagaggtgctgctcttcaacctcttc
ggggtgccgctggtgggtgccgacatctgcggcttcaggggcgacacgagcgaggagctg
tgcgtgcgctggacccagctgggcgccttctaccccttcatgaggaaccacaacgaccac
ggcacccggccacaggagccctacaccttcagccctgctgcccaggctgccatgaggaac
gccctgcgcctccgctactccctcctgccgttcctctacaccctgttccaccgggctcac
accgccggcgagaccgtggctcggccgctgttcctcgagttccccacagaccccaacagc
tgggccgtggaccgccagctcctgtggggcggggggctgctcgtcacccccgtgctggag
gcaggacagaccaaagtcagcggttacttcccggcggggacgtggtacagcctggcaggg
gactccaccatccacagcaaagggcagtggatcctcctgccagcccccctggacaccatc
aacgtccacgtccgtgcagggcacatcctgcccctgcaggagcccgccctcagcactgcc
cagtcccgcagcaagggcatggccttggtggtggcgctgaccctggacggcttcgccagg
ggagacctgttctgggacgatggggagagctgggacacctttgagaggggggactacacc
gagatcctcttcctggcctcaaacgacgccgtgctcagccagctgctgcgggcgagcccc
cacctcgacggggtcctgctggaggccgtgactgtgctgggtgtcaccagccctccccgg
agagtcctggccaacggtgccatcgtcagcgacttctcctaccgcagtgacacccaggtg
ctcagagtccctgtgtcactgcccatgtgggagcagtttgtgatctcctggtcctga

DBGET integrated database retrieval system