KEGG   Parus major (Great Tit): 107212812
Entry
107212812         CDS       T04864                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00220  Arginine biosynthesis
pmaj00330  Arginine and proline metabolism
pmaj01100  Metabolic pathways
pmaj04020  Calcium signaling pathway
pmaj04146  Peroxisome
pmaj04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107212812 (NOS2)
   00330 Arginine and proline metabolism
    107212812 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107212812 (NOS2)
   04020 Calcium signaling pathway
    107212812 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107212812 (NOS2)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107212812 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 107212812
NCBI-ProteinID: XP_015501978
LinkDB
Position
19
AA seq 1146 aa
MLCPWQFVFKSHAKNQYPREKDINNNMEKNRKIHGSEKADAKLCAPSKKQMEGLPIVTSA
KPSEGRENLPPNDIKVSNQISGCPGHVKVRNLENGSSFLDTLHLSAKEVISCRTKACQGS
VMTPKGLVRGTRDGPVPLEDLLPQAVDFLKQYYSSFKEPKIKEQLGRLETVTKEIETTGT
YHLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIQYATNNG
NIRSAITVFPQRTDGQHDFRVWNSQLIRYAGYQMPDGSVLGDPATVEFTQLCTELGWKPK
YGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYEWFRELDLKWYALPAVASMLLE
VGGLEFTACPFNGWYMGTEIGVRDFCDAQRYNILKEVGRRMGLETNKLSSLWKDRAVVEI
NVAVLHSFQKQNVTIMDHHSAAESFLKYMQSEYRARGGCPADWVWIVPPMSGSITPVFHQ
EMLNYVLSPFYYYQVDAWKTHVWHDETRRPRKKEIRFSILAKAVLFASSLMQGAVATRAK
VTVIYATETGKSETLANNLCSLFSCAFSTKILCMDEYNICDLEKETLLLVVTSTFGNGDS
PGNGKTLKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFAHAIDQKLSQLGASQLTPVGE
GDELSGQEEAFHSWAISAFKTACDIFNIRGRHSIQLPEIYSSEESWDPTNYRLVHDSQPM
DLAKALASIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLHCETNQEVHYLPGEHIGIFPA
NQAELVRGIIARVKDAPPADQTIRLETCIDGGYWTSHKKVPACTLPEALTYLLDITTPPS
QQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEISTAFLLT
QLPFLKPRYYSVSSSCDMTAREIHLTVAVVNYRTRDGKGPLHHGVCSTWLNTIELNETVP
CFIRSANDFHLPEEPARPCILIGSGTGIAPFRSFWLQRLYDLEHRGLRGGDMTLLFGCRQ
PDLDHIYREETEEMKRKGVLRDVYTAYSRLPGQDKVYVQDILQRQLEARVCEVLQVQQGH
IYVCGDVRMARDVARALRALLARGLRLSQQQANEYFQQLKSQKRYHEDIFGAVFPHEVKR
ALQPSS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgtgttcaaatctcatgccaagaaccagtaccccagagag
aaagatatcaacaacaacatggagaaaaataggaagatccatggctcagaaaaggctgat
gccaaattgtgtgctccaagcaagaagcagatggaggggctgcctatcgtaacttcagca
aagcccagtgagggaagagagaatctccctccaaatgacatcaaagtttcaaaccaaata
tcaggatgtccaggacatgtaaaagtaagaaatttggaaaatggatccagctttcttgac
acattacacctgagtgcaaaagaggttatcagttgccggaccaaagcctgccaagggtca
gtcatgaccccaaagggcctggtgagaggtaccagagatgggccagttccactggaagat
cttttacctcaggcagtagacttcctcaagcagtactacagttcctttaaagagccaaaa
atcaaagagcagctgggccggctggaaacagtgaccaaggagatagaaacaacaggaacc
taccacctgacaaaggatgagctgatctttgctgccaagcaggcctggaggaacgcgccc
aggtgcattggaagaatccagtggtccaatctgcaggtgtttgatgcacgggactgtaaa
acagccaaggaaatgtttgagcatatctgtcgtcatattcagtatgccacaaataatggt
aatataaggtcagccatcacggtgttcccgcagaggacggacgggcagcacgatttccgt
gtgtggaacagccagctgatccgctacgctggctaccaaatgccagatggctctgtcctt
ggagaccctgccactgtggagttcactcagttgtgcaccgagcttgggtggaagccgaaa
tatggccgctttgatgtacttccacttgttctccaagcaaatggccaagacccagaaata
tttgaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtacgagtgg
tttagggagctggacctgaagtggtatgcactgcctgctgtggccagcatgctgctggag
gtgggagggctggagttcaccgcctgtcccttcaatggctggtacatggggacagagatt
ggagtgcgggacttctgtgacgctcagcgctacaacatcctgaaggaggtggggaggaga
atgggactggaaacaaacaaactctcatcactatggaaggaccgagctgttgtagagatc
aatgtggctgtgcttcacagcttccagaaacagaatgtaaccatcatggatcaccactcg
gccgccgagtccttcctgaagtacatgcagagcgagtaccgtgcacggggcggctgccca
gcagactgggtgtggattgtgcctcccatgtcaggcagcataacccctgtgttccaccaa
gagatgctgaactatgtcctctctcccttctattactaccaggtggatgcatggaaaaca
catgtgtggcatgatgagacccgcaggccaaggaaaaaagaaataaggtttagcatcttg
gcaaaggctgtgctctttgcatcctcactcatgcaaggagcagtggccaccagggccaag
gtcactgtgatctatgccacagagacgggcaagtcagagacgctcgccaataacctgtgc
agcctgttcagctgtgccttcagcactaagattctgtgcatggatgagtacaatatttgt
gacctggaaaaagaaacacttcttttagtggttactagcacttttggaaatggagattct
ccaggtaacggaaagaccttgaaggactccttgctcagactgaaactgctgagaaataaa
attagatatgctgtgtttggtctgggatccagcatgtacccagagttctgtgcctttgct
catgccattgaccaaaaactgtcccaactcggggcttcccagctcactccagtgggtgaa
ggggatgaactcagtgggcaagaagaagctttccacagctgggcaatcagtgctttcaag
actgcctgtgacatttttaacatccgtgggagacacagtattcagttgcctgagatctac
agctctgaggaaagctgggaccctactaattacaggctagtgcacgactcccagcccatg
gacctggctaaagctcttgcaagcattcatgccaaggatgtaattcccatgaagctgaaa
ttcaggcagaatcttcaaagtttgaagtccagtcgtgttaccattctggttaaacttcac
tgtgagactaaccaggaagtgcattaccttcctggggagcacattgggattttcccagcc
aaccaggcagagttagtccgtggcattattgcacgagtcaaggatgcccctccagctgac
cagactatcaggcttgaaacctgcattgatggtggatactggacaagtcataaaaaggtt
ccagcctgcacactacctgaggctttgacatacctgcttgatatcactactccaccctcc
caacaactgctaaaaaaactctcccagctggtgacagcagaaggagacaagcagaggctg
gaggtgttgtgtcagagcacagaagaatacaataaatggaagttttacaacagcccgaac
atcctggaggtcctggaggaattcccctctgctgagatctccacagctttcctgctgact
cagctgccatttctgaagcccaggtactattctgtcagctcatcctgtgacatgacagcc
agagagattcatctgacagttgcagttgtaaactacaggacaagagatggaaaagggcct
ttgcaccatggagtctgcagcacgtggctgaacacaatagagctcaatgaaaccgttccc
tgcttcatccgcagtgctaatgacttccacctgccggaggagcccgccaggccctgcatt
ctgatcggctcgggcaccgggatcgctcccttcaggagcttctggctgcagcgcctctat
gacctggagcacagagggctcaggggaggggacatgacgctgctgttcggctgccgccag
ccagacctggaccacatctacagagaggaaactgaggaaatgaagaggaagggagtcctg
agagatgtctacacagcttactctagactgcctggccaagacaaagtctatgtgcaggac
atcctgcagaggcagctggaggcccgcgtgtgcgaggtgctgcaggtgcagcagggccac
atctacgtgtgtggggacgtgcgcatggcgcgggacgtggcgagggcgctgcgggcgctg
ctcgcccggggcctgcgcctcagccagcagcaggcaaacgagtacttccagcagctcaag
agccaaaagcgataccatgaagatatatttggggctgtgttcccacatgaagtcaaaaga
gctttgcaacccagcagctga

DBGET integrated database retrieval system