KEGG   Parus major (Great Tit): 107212971Help
Entry
107212971         CDS       T04864                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00512  Mucin type O-glycan biosynthesis
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107212971 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmaj01003]
    107212971 (WBSCR17)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107212971 (WBSCR17)
Glycosyltransferases [BR:pmaj01003]
 O-Glycan biosynthesis
  Mucin-type
   107212971 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107212971
NCBI-ProteinID: XP_015502416
LinkDB All DBs
Position
19
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITTKSGDSFHDIHPRAEVANLTAHGISSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGRGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTRCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
APLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKWHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTREGFLHLGALGTTTLLPDTRCLVDTGKSRFPQLLD
CDKVKSSLHKRWSFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgaggagagtcaaagtcctgctggtgttaaacctgatcgccgtggccggc
ttcgtcctcttcctggccaagtgcagacccatcacgaccaagagcggcgactccttccat
gacatccatcccagggcagaggtggccaacctgacagcccacggcatcagctccatccag
gatgcggtgctgaagaggctctcgctcctagaggacattgtctacaggcagctgaacggt
ttgtccaagtcccttgggctcattgagggctatggtggccgtggcaggggtggcctccca
gccaccctgtcccccgaggaggaagagaaagccaagggaccccatgagaagtatggctac
aactcctacctcagcgagaagatctccttggatcgctccatcccggattatcgcccgacc
aggtgcaaagagctgaaatacgggaaggacctgccccagatctccatcatcttcatcttt
gtgaacgaggcgctgtcggtgatcctgcgctcggtgcacagcgccgtcaaccacacgccc
gcgcccctgctgaaggagatcatcctggtggacgacaacagcgacgaggaggagctgaag
gcaccgctggaggagtacgtcaacaagcgctacccggggctggtgaaggtggtgaggaac
cagaagagggaagggctgatccgggcacgcatcgagggctggaaagctgccacgggccag
gtcaccggcttcttcgatgcccacgtggagttcactgctggctgggcggagccggtgctg
tcccggatccaggagaacaggaggagggtgatcctgccctccatcgacaacatcaagcag
gacaacttcgaggtgcagcgctacgagaactcggcccacggctacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggacgctggggacccctccctgcccatc
aggaccccggccatgatcggctgctccttcgtggtcaacaggaagttttttggggagatc
gggctgctggaccccggcatggacgtgtacggaggggagaacatcgagctgggcatcaag
gtgtggctgtgtgggggcagcatggaggtgttgccctgctccagggtggcgcacatcgag
cgtaagaagaagccgtacaacaacaacatcggtttctacaccaagcgcaacgcgctgcgc
gtggccgaggtgtggatggacgactacaagtggcacgtgtacatcgcctggaacctgccc
ctggagaacccagggattgacattggggatgtttctgagaggaaagccttgaggaagagc
ctgaagtgtaaaaatttccagtggtacctggaccacgtttatccagaaatgaggagatac
aacaacaccattgcttatggagagctgaggaacaacaaggccaaggacgtgtgtctggac
cagggcccacaggagaaccacacagcaatcctgtacccgtgccatggctggggcccacag
ctggctcgctacaccagggagggtttcctgcacctgggggccctgggcaccaccacgctg
ctgcccgacacccgctgcctggtggacaccggcaagagccgcttcccgcagctgctggac
tgtgacaaggtcaagagcagcctccacaagcgctggagcttcatccagaacggagccatc
ctgaacaagggcacgggccggtgcctggaggtggagaacaggggcatggctggcattgac
ctgatccttcgcagctgcactggacagaggtggacaattaaaaacttcatcaagtag

DBGET integrated database retrieval system