KEGG   Parus major (Great Tit): 107213276Help
Entry
107213276         CDS       T04864                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    107213276 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 107213276
NCBI-ProteinID: XP_015502995
LinkDB All DBs
Position
20
AA seq 581 aa AA seqDB search
MAAAAALLLLLLLVATGPGPGRADAGRERRDALWEELLLSPLPTGDVAATFQFRTRWDAD
LQRGAVSHYRLFPKALGRLVAALGVRELHLALTQGFWRTRYWGQPPLQAPAGAELWVWFQ
PTVTDVDKAWKELSNILSGIFCASLNFIDSTNTVIPTASFKPLGLANGTDHHLLRYAVLP
REVVCTENLTPWKKLLPCGSKAGLAVLLKAERLFHSSYHSQAVHIRPICRDASCLAVSWE
LRQTLTVVFDFFSSGQGKKDWSLFKMFSRTLTDTCPLASQSKVYVDISPKNKEKELLEVS
PTPTSVHEAIVQGDKKTYAVYDLLSPSLFNTSRSLNVQLKWKRPQDSSEMPIPTLHAQRY
VGGYGLQTGEICTLIYNTHPYRAFPVILLETVPWYLRLYVHTLTIITKGKENKPSYIHYQ
PAQDRRRPHLLEMLIQLPANSVTKITIQFERALLKWTEYPPDPNHGFYVGSSVLSALVPS
VTAMKDMDVEQSPLFASLFPSSDGSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVA
VCYGSFYNLLTRTFHVEEPSRGGLAKRLANVIRKLRGVPPL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcgttgctgctgctgctgctgctggtggcgacagggcccgggccc
gggcgggcggacgcgggccgggagcggcgggacgcgctgtgggaggagctgctgctgagc
ccgctgcccaccggcgatgtggccgccaccttccagttccgcacgcgctgggacgcggac
ctgcagcggggcgcagtctctcactacaggctcttccccaaggcgctggggcggctggtg
gcagcgctgggcgtgcgggagctccacctcgctctcacccagggcttctggcgcacccgg
tactgggggcagccgcccctccaggcacccgctggagcagagctctgggtctggttccag
cccacggtcaccgatgttgacaaagcctggaaagaactgagtaacatcctttcaggaata
ttctgtgcttctctcaacttcattgactcgaccaacacagtgattccaacagcatccttc
aaacccctgggtttagccaatgggacggatcaccatctcctgcgttacgctgtcctgccg
cgggaagttgtctgcacagaaaacctcaccccttggaagaagcttctgccatgtggctca
aaggctgggctcgctgtgctgctgaaggctgagcgcttgttccacagcagctaccactca
caggcagtgcacatccgccccatctgcagggatgcctcctgcctggctgtgtcctgggaa
ctcagacagaccctcactgtggtctttgacttcttttccagcggccaaggaaagaaagac
tggtccctctttaagatgttctctcgcacactgactgacacgtgtcctctggcatcgcag
agcaaagtctatgttgacatttcccctaagaacaaggaaaaggagctactggaagtgtcc
cccactccaacatcagtacacgaagctattgtccagggagacaagaaaacctatgctgtc
tatgacctgctgagcccctcgctcttcaacacatcccgcagcctcaacgtgcagctcaag
tggaagcggccccaagacagctcggaaatgcccattcccactctccatgctcagcgttat
gtaggggggtacgggctgcagaccggggagatctgcaccctcatctacaacactcaccct
taccgagccttccccgtgatcctgctggagactgtgccctggtacctgcggctctacgtg
cacaccctgacaatcatcaccaaagggaaggaaaacaagccgagttacatccactaccag
ccagcccaggaccggagacggcctcacctcttggaaatgctgatccagctgccagccaac
tcagtcaccaagatcacaatccagtttgagagggctttattgaagtggacagagtaccca
cctgacccaaatcacggcttttatgttggttcatctgtgctcagtgccctggtgcccagt
gtcactgccatgaaggacatggatgtggagcagagccctctctttgcctcactgtttcct
tcctctgatggctccagctattttgtgcgcctgtacacggagccgctgctggtgaatctg
ccaacaccagacttcagcatgccctacaacgtcatctgcctcacctgcaccgtggtggcc
gtgtgctacggctccttctacaacctgctgaccagaacgttccatgtggaggagccgagc
cggggcgggctggccaagcggctggccaacgtcatccgaaaactgaggggggtaccccca
ctctga

DBGET integrated database retrieval system