KEGG   Parus major (Great Tit): 107213781Help
Entry
107213781         CDS       T04864                                 

Gene name
PPCS
Definition
(RefSeq) phosphopantothenate--cysteine ligase isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00770  Pantothenate and CoA biosynthesis
pmaj01100  Metabolic pathways
Module
pmaj_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    107213781 (PPCS)
Enzymes [BR:pmaj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     107213781 (PPCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 107213781
NCBI-ProteinID: XP_015504076
LinkDB All DBs
Position
21
AA seq 313 aa AA seqDB search
MAAVAKEEKDKDEDNNVDVAATEGRVRAWAAAQAARGRRVALVTSGGTQVPLEARAVRFL
ENFSSGRRGAASAERLVRAGYGVCFLHRARSAFPWARALPPHGPALLDALCLTPGPPPGV
AAAPAALPALLPALREYRRATEAGALLPIEFTGLVEYLALLRAAARALAPLGSSVMFYLA
AAVSDFYIPVSEMPEHKIQSSEGPLQITMKMVPKMLSPLVRDWAPEAFVISFKLETDPQI
LLDKSRQALEKYRHQVVVANVLESRRTSVIIVTRDSQTPLSLSDEEIAQGMEIEEKIVSY
LQGQHTAFIERKG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggcgaaggaggagaaggacaaggacgaggacaacaacgtggatgtggcg
gcgaccgagggccgggtgcgggcttgggcggcggcgcaggcggcacgcgggcggcgcgtg
gcgctggtgacgtcaggcgggacgcaggtgccactggaggcgcgtgccgtgcgcttcctg
gagaacttcagcagcggtcggcgcggggctgcctcggccgagcgactcgtgcgggcgggg
tacggtgtgtgctttctgcaccgcgcccgttccgccttcccctgggcccgcgccctgccg
ccgcacgggcccgcgctcctcgacgctctctgcctcaccccggggccaccgcccggcgtg
gccgccgcccccgccgcgctgcccgcgctgctgcccgcgctccgcgagtaccgacgcgcc
accgaggctggcgcgctgctccccatcgagttcaccgggctcgttgagtacctggcgctg
ctgcgcgcggccgctcgagccctggcgcccctcggctccagtgtcatgttctacctggca
gctgccgtgtcggatttctacatcccggtctctgagatgccggagcacaagatccagtcc
tcagaggggcccctgcagatcacaatgaagatggtgccaaaaatgctgtcacccctggtc
agagactgggctcctgaggcctttgtgatttccttcaaactggagacagatccccagatc
ctcctggataaatctcggcaggctctggagaaataccggcaccaggtggtggtggccaat
gtcctggaatcccggagaacctctgtcatcattgtcaccagggactcacagactccctta
tccctgtccgatgaggaaatagcacaaggcatggaaatagaggagaagattgtgagttac
ctccagggccagcacacggcctttatagagagaaaaggttga

DBGET integrated database retrieval system