KEGG   Parus major (Great Tit): 107213875Help
Entry
107213875         CDS       T04864                                 

Gene name
GCK
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00010  Glycolysis / Gluconeogenesis
pmaj00052  Galactose metabolism
pmaj00500  Starch and sucrose metabolism
pmaj00520  Amino sugar and nucleotide sugar metabolism
pmaj00524  Neomycin, kanamycin and gentamicin biosynthesis
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
pmaj04910  Insulin signaling pathway
Module
pmaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmaj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107213875 (GCK)
   00052 Galactose metabolism
    107213875 (GCK)
   00500 Starch and sucrose metabolism
    107213875 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    107213875 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107213875 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107213875 (GCK)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     107213875 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107213875
NCBI-ProteinID: XP_015504231
LinkDB All DBs
Position
22
AA seq 465 aa AA seqDB search
MLDHRARMESSRKEKVEQILSEFHLKEEDLKKVMYRMQKEMDRGLKLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLKLVDENLLFNGEASEKLKTRGTFETRFMSQIESDSDDRKQIYNILSAFELLPS
RTDCEIVRRVCESVSTRAAQMCSAGLAGVINRMRESRSQDTLKITVGVDGSVYKLHPSFK
DHFHATVRQLTPGCDITFIQSEEGSGRGAALISAVACKMACMMGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcaccgagccaggatggagagcagcaggaaggagaaggtggagcagatcctg
tcggagttccatctgaaggaggaggacctgaagaaggtgatgtaccggatgcagaaggag
atggaccgagggctcaaactggagacacatgaggaagcctctgtcaaaatgctgcccacc
tatgttcgttccacccctgagggctctgaggtgggagatttcctgtcactggacctgggt
ggcaccaatttccgtgtgatgctggtgaaggtgggcgagggggaggaggggcagtggaag
gtgaagacgaagcaccagatgtattccatcccagaggatgccatgaccgggacggctgag
atgctttttgactacatctccgagtgcatctctgatttcctggacaagcaccagatgaag
cacaaaaagctgcccctgggcttcaccttctccttccctgtgcggcacgaggacatcgac
aagggcatcctcctgaactggaccaagggcttcaaagcctccggcgcggaagggaacaat
gtggtggggctgctgagggacgccatcaaacggcgaggggacttcgagatggatgtggtg
gcaatggtgaatgacacagtggccacgatgatctcctgctactacgaagatcaccggtgc
gaggttgggatgattgtggggacgggctgtaatgcctgctacatggaggagatgcacaac
gtggagctggtggagggcgacgaggggcggatgtgtgtgaacacggagtggggagccttt
ggtgcctctggggagctggacgagttcctcctggagtacgaccgcgtggtggacgagacc
tcacttaaccccggtcagcaactgtacgagaagatcattggagggaagtacatgggggaa
atcgtgcggctggtgctgttgaagctggtggatgagaacctgcttttcaacggggaggcc
tctgagaagctcaagactcgtgggacttttgagacccgcttcatgtcccagattgagagt
gattccgatgaccgcaagcagatctacaacatcttgtcagcctttgagctgctgccatct
cggacagactgcgagatcgtgcgccgggtgtgtgagagcgtgtccacacgggctgcccag
atgtgttcggccgggctggccggcgtcatcaaccgcatgcgggagagccgcagccaggac
accctcaagatcactgttggtgtcgatggctccgtctacaagctccatcccagcttcaag
gaccacttccatgccacagtgcggcagctgacgcctggctgtgacatcacgttcatccag
tcagaggaaggcagcgggcgcggggccgctctcatctcagccgtggcctgcaagatggcc
tgcatgatggggcagtga

DBGET integrated database retrieval system