KEGG   Parus major (Great Tit): 107214308Help
Entry
107214308         CDS       T04864                                 

Gene name
TMPRSS5
Definition
(RefSeq) transmembrane protease serine 5
  KO
K09636  transmembrane protease serine 5 [EC:3.4.21.-]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmaj01002]
    107214308 (TMPRSS5)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107214308 (TMPRSS5)
Peptidases [BR:pmaj01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107214308 (TMPRSS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Trypsin_2 Hepsin-SRCR DUF1986
Motif
Other DBs
NCBI-GeneID: 107214308
NCBI-ProteinID: XP_015505067
LinkDB All DBs
Position
24
AA seq 298 aa AA seqDB search
MSRQKGVKLADVGVGAGQQFLQVTPGQEGSLEDMWQVRSSCQSGRIVALQCSECGLQAGV
LRVVGGTDVSPGRWPWQVSVCQGSQHRCGGSVLAPEWILTAAHCVHRQLPAPAWQVFAGI
VTQGSLKPEAGVPVRDIIPHPLYNESSLDYDIALMRLQVPLNFSGAIRAVCLPPSPQDLL
QGTQCWVSGWGYTTPGQAQVAGTLKEALVPLIGTRRCNSSCGYRGELTARMLCAGHLQGR
VDACQGDSGGPLVCWDGAMWRLVGIVSWGRGCAEPNHPGVYTNVAQLLPWIHQVTQLH
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagaagggggtgaagctggccgatgtcggggtgggtgctgggcagcagttc
ctgcaggtgacacccgggcaggaaggcagcctggaggacatgtggcaggtcaggagcagc
tgccagtccggtcgaattgtggctctgcagtgctcagagtgtgggctgcaggcgggggtc
ctgagggtggtggggggcacggacgtgtcccccgggcgctggccctggcaggtcagtgtg
tgccagggctcccagcaccgctgtgggggctccgtgctggcccccgagtggatcctcaca
gcagctcactgtgtgcacaggcagctcccagccccagcctggcaggtttttgcgggcatt
gtcacccagggctcgctgaagcccgaggcgggggtgccggtccgggacatcattccgcac
ccgctctacaacgagagcagcctcgactacgacatcgccctgatgaggctccaagtgccc
ctcaatttctcaggtgccatccgagccgtgtgcctgccgccgtccccgcaggacctgctg
cagggcacgcagtgctgggtgtcgggctggggctacaccacccctggccaagcacaggtg
gccgggacgctgaaggaggctctggtgcccctgatcggcacccggaggtgcaacagctcc
tgcgggtacaggggtgagctgacggccaggatgctctgtgcaggacacctgcagggccgt
gtggacgcctgccagggggacagcgggggcccgctggtgtgctgggatggagccatgtgg
cgcctggtgggaattgtcagctggggccggggctgtgctgagccaaaccaccccggggtc
tacaccaacgtggctcagctgctgccctggatccaccaggtcacccagctccactag

DBGET integrated database retrieval system