KEGG   Parus major (Great Tit): 107214716
Entry
107214716         CDS       T04864                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04012  ErbB signaling pathway
pmaj04068  FoxO signaling pathway
pmaj04110  Cell cycle
pmaj04115  p53 signaling pathway
pmaj04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107214716 (CDKN1A)
   04068 FoxO signaling pathway
    107214716 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107214716 (CDKN1A)
   04115 p53 signaling pathway
    107214716 (CDKN1A)
   04218 Cellular senescence
    107214716 (CDKN1A)
SSDB
Motif
Pfam: CDI RNA_pol_Rpb2_3
Other DBs
NCBI-GeneID: 107214716
NCBI-ProteinID: XP_015505841
LinkDB
Position
26
AA seq 151 aa
MPLSQSRAGQTPCSSKVCRNLFGPVDHEQLQHDFEDKIRQQLEEAQQRWNFDFETETPLE
GPFKWERILVAEQPSQEVHSLVSAVTSSDSRSSLAHRVPPKDHVGRICPEESEESSKAYK
AGSSQSLKRGQTTIKDFYSAKRRIVPARPRP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgctgtcccagagcagggctgggcagaccccgtgcagcagcaaggtgtgcaggaac
ctctttggccccgtggaccacgagcagctccagcatgactttgaggacaagataagacag
cagctggaagaagctcagcagcgctggaacttcgactttgagacagagactcccttggaa
gggccgttcaagtgggagaggatcctcgtggctgagcagccgtcccaggaggttcacagc
ctggtcagtgctgtcaccagcagtgacagcaggagctccttggcccacagggtccccccc
aaggaccatgttggcaggatttgccctgaggagtctgaagagagctcgaaggcttacaag
gctggttcctcgcagagcttgaaacgtgggcagaccacgatcaaagacttctacagtgcc
aagcggaggatcgtccctgcgcggccccggccgtga

DBGET integrated database retrieval system