KEGG   Parus major (Great Tit): 107215307Help
Entry
107215307         CDS       T04864                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04210  Apoptosis
pmaj04625  C-type lectin receptor signaling pathway
pmaj04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107215307 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107215307 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107215307 (MAP3K14)
   04672 Intestinal immune network for IgA production
    107215307 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107215307 (MAP3K14)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107215307 (MAP3K14)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: STE group
  Other
   107215307 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 107215307
NCBI-ProteinID: XP_015506885
LinkDB All DBs
Position
27
AA seq 939 aa AA seqDB search
MAVMGIECQGAPDPAIKHKKEPTAAKGLKETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSSRSDSLDHIPNN
VAHATEGRMAPTWRGRHRGRAKKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQED
ESHQSTLYRNSFWVPEFNKDLGYDPLSFEKCAHAPLSTGKLHSPRSQYKTELHKLISPIQ
CLNHVWKQRDTVPQPETLHPFPYNILPPHFPLVDNPLHAMKHSALDTYFNGDLNYQDSRL
SGLNLEYNFTKYINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLEL
KEQFHEASENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCA
AKKVQVEHFRAEELTMCAAVTSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCL
PEDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLG
KCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLK
IAKEPPPLREIPPSCNPLTAEIIKLGLEKEPLHRASASELKTKTCVALEEVGGVRSPWKG
EYREPRHLSLSKENSAQTSLSPTVSPVSETGSDPKLSVKVSCASPVPPPPSLEQTEEVEG
SHWNEGKELPETWDPPPLSSTPLPLKSCSHMERATTISEQELQQLEIELFLNSLSQPYSL
EEQEQMLSCLSIDSPFVSDASEKNSMKASQSLRDTMSSGIHSWNSQADGQSCSWNNLLSR
SRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQP
VRYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattgaatgccagggagctcctgatccagccatcaagcacaaaaag
gagcccacagctgccaaggggctgaaggagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgcccacagtaaacgttacagcagccgctcggacagcctcgatcacatccccaacaat
gtggcccatgccacggagggcaggatggcgcccacctggcgagggaggcaccggggcagg
gccaagaagaaacggcacaagaaaagatccaagctgaaaggacaacctgtggctgctggc
aggagaagtccaagaactccagaacaggagagctgcaccccaattcctgtccaggaggat
gaatcccaccaaagtactctttacagaaacagtttttgggttcctgaatttaacaaagac
ttgggctacgatccactgtcttttgagaagtgtgctcatgctcctttgtccacgggcaaa
ctccattccccaaggagccaatacaaaactgaactgcacaagctgatcagccctattcag
tgccttaatcatgtttggaaacagagggacactgttccccagcctgagactctccatcct
tttccctacaacatccttcccccacatttcccacttgtggacaatcctctccatgccatg
aagcacagtgctctggacacatacttcaatggtgacctcaactatcaagacagtcgctta
tctggcctaaacttagaatataatttcaccaaatacatcaaccagtccgtgcaaaccagt
tcagacaagctttctgtggaagaatatttggtagatgccttgaaggggagcgtgagtttt
ggtgaaccacaaaatttagccagcctggccaagacgtggagaggaggtgggctggagctg
aaggaacaattccatgaagcgagtgagaatgaaggcgtgctgctgaacgagaagttgaag
ccagtggattacgagtaccgagaagaggttcactggacaaagtgccatggttccttgggc
attggctcttttggggaagtgtacaagatagaggacaagcagacaggatttcagtgtgct
gccaagaaggtgcaggtggaacacttccgtgccgaggagctgacgatgtgcgcggccgtg
acgagccccagcgtggtgcccctgtacggagccgtcaaggagggcccctgggtcaccatc
ttcatgaagctgatggagggtggctcattagggcagctcattaaacagagtggctgcctg
ccagaggacagagccctcagctacctgggccaggtgttagagggtctggagtatcttcat
gctcaaaacattctccatggagatgtcaaagcggagaacgtgctgctgtcggacgatggg
agcagggccctcctgtgtgactttggccactctgctcacctgcacccagatgggctggga
aagtgcttggtcacagggaactacgtgcctggcacagagacccacatggccccggaggtg
gtgatggggaagcgctgtgactccaaggtggacgtgtggagcagctgctgtatgatgctg
cacatgctcaacggctgccacccctggacccagtactacaaccaccctctgtgcctgaag
atcgctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctcactgct
gagattattaaactggggctggagaaggagcctctgcacagggcatctgcatcagagctc
aaaactaagacctgtgtggcactcgaggaagtgggaggtgtgagaagcccctggaaaggt
gaatacagagagcccagacatttatctttgagcaaagaaaacagtgcacagacatccctg
tcccctacagtgagcccagtttctgagactggttctgacccaaaactgtcagtcaaagtt
tcctgtgccagcccagtcccaccacctccatctctggagcaaacagaggaggttgaggga
agccactggaatgagggcaaggagttacctgagacctgggaccccccacctctctcctca
actcctctgcccctgaagagctgcagccacatggaaagagccacaaccatttcagagcaa
gaacttcagcagctggaaattgaactgtttctgaacagcctttcccagccttactctctg
gaagagcaagagcaaatgctttcatgcctcagcatcgacagcccctttgtgtcagatgcc
agtgagaagaactctatgaaggcttctcagagcttgagggacaccatgagctctgggatc
cattcctggaacagccaggcagacgggcagagctgcagctggaacaacctgctgagccgc
agccggcacacggacactcccagctacttcaacggagtgaaaatccagatccagttgcta
agtggagaaaatttgcacatcagagatttccacaggacaaaggtgggagacattgccaca
gggataagcagccagatccctgtgcctgccttcagcctggtgaccaaggaggggcagcct
gtgcgctatgacatggaggtgcctgactctggcatcgagctgcagtgcaccctggccccc
gactgcagcgtcagctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system