KEGG   Parus major (Great Tit): 107215352Help
Entry
107215352         CDS       T04864                                 

Definition
(RefSeq) platelet glycoprotein Ib alpha chain-like
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107215352
CD molecules [BR:pmaj04090]
 Proteins
  107215352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_5 TPKR_C2 LRRNT
Motif
Other DBs
NCBI-GeneID: 107215352
NCBI-ProteinID: XP_015506946
LinkDB All DBs
Position
28
AA seq 715 aa AA seqDB search
MQVPALTLVTLLALLSPAQPCPSEMNKVKDLLEVNCTGKALRAVPPDLPADTGILLLSNN
YLESLSTAAFLPLTQLQDIDLANNGLVALHTGALLPSLKELTLSHNALAALPILEGLPAL
THLAVAHNSLETLAPGAFRTVPQLQNLDLRGNKMQQLPWEAFAGLTALKELDLSDNLLKE
LPKELLQDLQKLETLWLSGNQLQTLPTDFFPKGRLFMYVFLTENPWNCNCDLHYLQTWIQ
KNADIVYQPERGLEETKVEVAPEKVLCHSPTEHREKPIIHFKLNCSIVEDADEEGGDEYN
YGEETTEKGTVTIFPPHGFIPKEHATMPCAVTSSCLPTLTTTGSPLTRPSFSTPCTSTLS
PSTLLVMLTSIRAPSTTTPVPASPTMISPQNPSTATILTAATTITLHRPATLDNATSLPT
AISRNPSSTSGHPQTTLAASTIYGSLMGSTGTFLTTSTAVPSTAMQEASSIVISPSPPPM
LANTTLSTHATTLPPPLDTRHFTQPACSPLPAPPSLCPCSIPGQAVPVLRLQAGGEGPQW
GQWVLRHCCLLHWVLYLASLFVLVLTMLALAGWMAWMCLVGKPSWHQSLQTQEVRYPLQE
WRESTGNPMMHLSSFKIPLQQPTFCTIKEVDLCPEVTYCTIKDLGIQHSPPASYSFCTTK
ELWVHHSPLHTSVKPFSRKLMVTDLGFLRTPSAYSLDTGVKAIGDVRVKYAGNTM
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccctgccctgaccctggtcactctcctggccttgttgtccccagcccagccc
tgcccctcagagatgaacaaggtcaaggacctcctggaggtgaactgcacagggaaggct
ctcagggcagtgcccccagacctgcctgcagatacaggcatcctacttctcagcaacaat
tacctggagtccctctccaccgctgcctttctgcccctcacccagcttcaggacatcgac
ctggccaacaatgggctggtggctctgcacacaggggccctgctgccatccctgaaggag
ctgaccctctcccacaatgcactggcagccctacccatcctggagggcctgcctgcgctc
acccacctggctgtggcccacaacagcctggagacactggccccgggggctttccgcaca
gtgccacagctgcagaatctggacttgagagggaacaagatgcagcagctgccctgggag
gcctttgcagggctgacagcactcaaggagttggacctctcagacaacctcctgaaagag
ctacccaaggagttgctgcaggacctgcaaaagttggagaccctctggctctcaggaaac
cagctgcagaccctgcccactgactttttcccaaaggggcgtctcttcatgtatgttttc
ctcactgagaacccctggaattgcaactgtgacctgcactacctccagacctggatccag
aagaatgctgacattgtttatcagccagagcggggcctggaggaaacaaaggtggaggtc
gcacctgagaaggtactgtgccacagccctactgagcatagggagaagcctatcattcac
ttcaagcttaactgcagcattgtggaggatgcagatgaggaaggaggggatgaatacaat
tatggggaagaaacaacagagaaaggcaccgtgaccatcttccccccacatggattcatc
cccaaagagcacgctaccatgccctgtgctgttacctcatcttgccttcctaccctcact
accacaggatctcccctcaccagaccttccttcagcaccccttgtacctccaccctttcc
ccaagcactttgcttgtaatgctgacaagcatcagagctcccagcaccaccactcctgta
ccagccagtcccaccatgatatccccacagaaccccagcactgctaccattctcactgct
gctactaccatcaccctgcacagacctgccacccttgataatgccacctcgctgccaaca
gctataagcagaaacccttctagcaccagtggccatcctcaaaccactcttgctgccagc
actatctatggtagtctcatggggtccactggcacatttctcactacttccacagcagtg
ccttctactgccatgcaagaagcttcttctattgtcatatctccatctcctcctccgatg
ctggccaacaccacgctttccactcatgccacaacactaccacctcccctggacactaga
catttcacccagcctgcatgctcccccctacctgctcctccttccctctgcccttgctcc
atcccaggacaggctgtacctgtgctgcgtttgcaggcaggtggggagggtccacagtgg
gggcagtgggtgctgaggcactgctgcctgttgcactgggtgctctacctggcttccttg
tttgtgctggtcctgaccatgctggctctagcaggttggatggcatggatgtgtctggtg
ggaaaaccctcctggcaccagtccttgcagacccaagaggtgcgatatccactgcaggaa
tggagggagtcaacaggaaaccctatgatgcatctcagcagtttcaaaatacccctccag
caacccacattctgtacaatcaaggaagtggacttgtgccctgaggttacctactgcaca
attaaagatctggggatacagcacagtcctcctgcaagttactctttctgcactacaaag
gaactgtgggttcaccacagtcctctgcacacatcagtcaagcctttttccaggaagctg
atggtcacagaccttggcttcctgaggaccccatctgcttacagcctagacacaggtgtc
aaggccattggtgatgtcagagtgaaatatgcaggtaacaccatgtaa

DBGET integrated database retrieval system