KEGG   Parus major (Great Tit): 107215544Help
Entry
107215544         CDS       T04864                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107215544 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmaj03036]
    107215544 (DOT1L)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107215544 (DOT1L)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107215544 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 107215544
NCBI-ProteinID: XP_015507261
LinkDB All DBs
Position
28
AA seq 1722 aa AA seqDB search
MGERLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKIQ
ENKDSGAEEEKAAANSVKKPSPSKARKKKLSKKGRKMAGRKRGRPKKMNTASTERKTKKN
QTALELLHAQTVSQTSSSSPQDAYKSPHSPYYQLPPKVQRHSSNQLLVAPTPPALQKLLD
SFKIQYMQFMAYMKTPQYKASLQQLLEQEKEKNAQLMGTAQQLFTHCQAQKEEIKRLFQQ
KLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKL
DWSTLSLENLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELLQLKSYTPSEEPL
SVQLHSKSHLSRDPEAEHGRFQLELECSKFPMPHINGMSPELSMNGHATPYELQHAFSRP
SSKQNTPQYPNSHLDQDIVPCTPNHSRQKADKVTSLSLPDYTRFSPAKIALRRHLNQDHG
VNGKATASEIQRAEHVKENGLTYPSPGIANGIKLSPQETRPSSPAALPSAGEKVLRERTS
VSNGETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQSRDSSTLEK
QIGASSHNGISNAAGNKPLALATSGFSYSSGSVAVNGNLTNSPAHLNHSVDQAALDDSGS
LFNSVGSRSSTPQHPLLMMRNSGQNSPAQQHSSPRLSGPAPSLAGGLQSAEAQKIFAEGT
KGDLQSDAAFSDPENEAKRRIIFTISPNTGHVKQSPCSKHSPVPAGARPAGGQAHAQDGK
KRGRRKRSSTGNPSGSAAVSPKRKSLPSVAGLFTQPSGSPLNINSMVNNINQPLEITAIS
SPENSLKNSPVPYQDNDQPPVLKKEKPLVQSNGVHYSPLTSDDEQGSEDEHNSSRIERKI
ATISLESKSPQKTVENGGSLSGRKQAQSNENMNSSKWKSTFSPISDINLTKTTDSPLQAV
SALSQNSLFAFRPPSEDGLAMDTKVPGHPRKSLAVPSDGLSPGTNPPNGFTYNGGLSSEL
GLHGFMDSAALPHKAPDGTAPTCSLGFPSQRGKDLGVSDTNLFLNKRQLEGLGTKGEELS
RPGVKGKELSELSARAGGSAEKNSVQHNGKVGKGRDRDVEFKNGHNLFISAAVSSGGLLN
GKSLSTAVSSAGNPAPSVPTHHPFLNTLTTGSQFPLGPMALQANLNSVTNSSVLQSLFNS
MPAAASLVHVSSAATRLTNSHTMGNFSPGVTGGTVGGIFNHAVPSASSPHQFGASFSSSA
VSSSTVLSLNPLQAVASTSSSSFPPSSSNLVTSSETRPAQHLNRAPVQSVFHPPPPPPNV
SLPPPPPLLASNSEPALLQNLPSIPPGETFLPSSSAPVQSNSSLSIKLASLQHKPSRPSF
TVHHPPLPRVLPQPNAAGTAAMWVTLGMQPPYASHLSGVKPR
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaggctggagctgcggctgaagtcgcccgtgggagccgagcccgccgtgtac
ccctggccgctgcccgtctacgacaaacaccatgatgctgctcatgaaattattgagaca
attcggtgggtctgtgaagaaatcccagatctcaagcttgccatggaaaactatgtttta
attgactatgatacaaaaagctttgagagcatgcagagactgtgtgacaaatacaaccga
gccatcgacagcatccaccagttgtggaaggggacgacgcagcccatgaagctgaacacg
cgtccctccaacgggctcctgaggcacatcctgcagcaggtctacaaccactcggtcaca
gaccctgagaaactcaacaactacgagcccttctcccctgaggtctacggagaaacttcc
tttgacttggtggcccaaatgattgatgagattaaaatgacagaggatgatttgttcgtt
gacttgggcagtggtgtggggcaggtggtgcttcaagtggctgcagccacaaactgcaaa
catcactatggagtggagaaagctgatattccagccaagtatgccgagacgatggacaga
gagttcagaaaatggatgaaatggtatgggaagaaacatgcagaatacacactggaaaga
ggtgacttcctctcagaagaatggagagagaggattgcaaacacaagtgttatttttgtc
aataactttgccttcgggcctgaggtggatcaccagctgaaggagcgctttgcgaacatg
aaggaaggtgggagaattgtgtcctcaaaaccttttgcacctctaaattttagaattaac
agtcgaaacttgagtgatattggcactatcatgagggttgtggagctgtcaccactgaag
ggctccgtgtcctggacggggaagccagtctcctactacctgcacacgattgacagaacc
atacttgaaaactatttttctagtctcaaaaatccaaaactcagggaggaacaagaggca
gctagacgtcgtcaacaaagagaaaacaaaagtaacacaacgactccaaccaagatccaa
gaaaacaaggattctggtgctgaagaagaaaaagctgcagcaaattctgtaaaaaagcca
tctccctccaaggcccggaagaaaaagctgagtaagaaaggcaggaaaatggcagggagg
aaacgaggccgccccaagaaaatgaacacagcaagtactgaacgcaagaccaagaagaac
caaactgcactagaacttctgcatgctcagactgtctcccagacatcttcatcctctcct
caggatgcctacaagtcacctcatagcccatattaccaactacctcctaaagtgcaacgg
cattcgtccaaccagctcctggtggcacccaccccccctgcactacagaagctgctagac
tcatttaagatccagtacatgcagttcatggcatacatgaaaactcctcagtacaaagca
agtctgcaacagttactggagcaggaaaaggagaagaatgctcagctgatggggacagcc
cagcagttattcacccactgccaggcccagaaagaggaaatcaaacgcctgtttcagcag
aagctcgatgagttgggagttaaagctctgacgtacaacgacctgatccaggctcagaag
gaaatctctgctcacaaccagcagctgaaagaacagacaaaacagctggagaaggacaac
agtgaactcaggaaccagagcttgcagctgctgaaggctcggtgtgaagaactgaagctg
gattggtcaacgctgtcactggagaacttgctgaaagagaagcaggccttgaagaatcag
atttctgagaagcaaaagcactgtttggaactgcagatcagcattgtggaacttgagaag
agtcagcggcagcaggagctgctgcagctcaagtcctacacaccctcagaggagcccctg
tcagtgcagctgcacagcaaaagccacctgagccgtgaccccgaggctgagcacggcagg
ttccagctggagctggagtgctccaagttccccatgccccacatcaatggcatgagcccc
gagctgtccatgaacggccacgccaccccctacgagctgcagcacgccttcagccggccc
tcgtccaagcagaacaccccccagtaccccaactcccacctggaccaagacatcgtgccc
tgcacccccaaccacagcaggcagaaggcagacaaggtgacgagcctgtccctccctgat
tacaccaggttttcccctgctaaaatcgccctgcggagacacttgaaccaggaccacgga
gtcaatggaaaagcaacagctagtgagatacagagagctgagcatgtcaaagagaatggc
cttacatatccaagccctggaattgcaaatggcataaagctgagtcctcaggaaactcgg
ccctcctcccccgcggccttacccagtgcaggagagaaggttttgagagagagaacctct
gtgagtaatggagaaactatcaccagcctccctatcagtattcctctgagcacagtgcag
cccaataaactccctgttagtatccctctggccagcgtagtcctacctagccgtgttgag
aaggtgagaagcacacccagcccagttcaccagagtagagactcatcgacacttgaaaag
cagattggtgctagttctcataatggcataagcaatgctgctggaaacaagcctctggct
ttggctacctcaggtttttcttactcttctggctccgtggcagtcaatggaaatcttaca
aacagcccagcccatcttaaccatagtgttgatcaggcagctctggacgactctgggagt
ctctttaactctgtagggtctcggagttccactccacaacatcctttgctaatgatgagg
aactctgggcagaactcccctgctcagcagcactcgagcccccgcttaagtggcccggcc
ccgagcctggcagggggactgcagagtgcagaggctcagaagatctttgccgaaggaaca
aagggggacctgcagtctgatgcagcgttttcagatcctgagaacgaggccaagaggaga
atcatctttacaatctctcctaatacaggacatgtaaaacaatccccttgcagcaagcac
agccccgtgcccgccggcgcccggccggccggcggccaggcccacgcgcaggacgggaag
aagcgcggccggcggaagagatcctccacgggcaatcccagcgggagcgccgccgtctcc
ccgaaacgcaaatccctgccctcggtggccgggctctttacgcagccctcggggtctccg
ctcaatatcaactccatggtcaataacattaaccagcccttagaaataacagccatttcc
tctcctgaaaactccctgaagaactctcctgttccttaccaggacaatgaccagccccca
gtgctgaaaaaggagaagcccctcgttcagagcaacggtgtccattactcccccctgaca
tcggatgacgagcagggctctgaggatgagcacaatagcagcagaattgaaaggaaaatt
gcaacaatatcattggaaagcaaatctccacagaagactgttgaaaatggtggcagctta
tcggggaggaaacaagcacaaagcaacgagaacatgaacagcagcaaatggaaatcgact
ttttcaccgatatctgacatcaacctgaccaaaaccacagacagccccttgcaggcggtg
tcagccctgagccagaactccctgtttgccttcaggccgccctctgaggacgggctggcc
atggacaccaaggtgccaggacaccccaggaagagcctggcagtgccctcggatgggctg
agccctggcacaaacccccccaatggcttcacctacaacgggggcctgtcctccgagctg
ggcctgcacggcttcatggacagcgccgctcttcctcacaaagctccggacgggacggct
cccacctgctccctgggcttcccctcgcagcgaggcaaggacctgggggtgtcagacacc
aaccttttcctgaacaagaggcagctggaaggtctgggcaccaagggagaagagctgagc
cggccgggggtgaagggcaaagagctcagcgagctgagcgctcgagcgggggggtctgcg
gagaaaaactctgtgcagcacaacggaaaggtcggcaagggaagggaccgagacgtggag
tttaaaaacggccacaaccttttcatttctgctgctgtttcgtctggtggccttctgaat
ggtaaaagcctttctactgctgtttcctcagcagggaacccagcaccgtctgtcccgacg
caccatcctttcctcaacactctgaccactggatcgcagttccccctcggccccatggcc
ttgcaagcaaacctcaactcggtgacaaattcctcagtattgcagtccttatttaattca
atgccagctgctgccagtctggtccacgtgtcatcagctgcaaccagactgactaattct
cacactatggggaacttctctcctggggttacaggtggaacagttggaggtatttttaac
catgcggtgccttctgcctcctctcctcatcaatttggagccagtttcagcagcagtgct
gtctctagcagcaccgtgctaagcttaaaccctctgcaggctgttgccagcacctcatcc
tcatccttcccaccctcttcctctaatttagtaacatctagtgagactagacctgctcag
cacctcaacagagctccagtgcaatctgtcttccatccccctccgccccctcctaacgtg
tccttgcctcctcctcctcctttactcgcttctaactccgagcctgctctcctgcagaac
ctgccctccatcccccccggcgagacgttcctgccctcctcctctgctcctgtccagtct
aactcttctttgtctattaaactggcttctctccagcacaaaccctcccgtccctccttt
acagtccatcacccgcccctgccccgcgtgctcccgcagcccaacgccgctggcacggcc
gctatgtgggtcacccttggcatgcagcctccttatgcttcgcacctttcgggggttaag
ccacgataa

DBGET integrated database retrieval system