KEGG   Parus major (Great Tit): 107215550Help
Entry
107215550         CDS       T04864                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmaj01002]
    107215550 (TMPRSS9)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107215550 (TMPRSS9)
Peptidases [BR:pmaj01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107215550 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 107215550
NCBI-ProteinID: XP_015507279
LinkDB All DBs
Position
28
AA seq 1099 aa AA seqDB search
MDQIKTGQGTQRRRLGACCWKVTAAAAVVGSATALCLGILLACHSTGEASFEHTVELKGI
TFNSSLQMENSDYYRVLTPALERLFLSSLQDSQLNWSCTGCTILGYSRNGNSGVIVHFRL
LFTPQDSQPLSSTLEEEALRHGLAAALHKQAFPLAAYGTISSASLTGPNKVSSHRPGLKS
DCGSRPAMQTTSRIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQ
DPAMWAAYTGTTSLRGSDSSAVKMDISQIIPHPSYNADTADYDVAVLELKRPVTFTKYIQ
PVCLPDAGHHFPTSKKCLISGWGYLKEDFLVKPDFLQKATVELLDQNLCSSLYSHVLTDR
MMCAGYLEGKVDSCQGDSGGPLVCQEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTKLRD
WILDAISAFPTSIAHTVPPVHFRTNSNMVSAEEVNTTTGETPTTSPAPAASRPVTAARPQ
ECGGQPGFSTPSKIVGGTDASRGEIPWQVSLKEDSRHFCGATIIGDRWLLSAAHCFNETM
PEEIEAYVGTTSLNGTDENAVKVSVKRVVPHPLFNPMILDFDVAVLELARPLVFNKYIQP
VCLPLAVQKFPVGKKCLISGWGDLQEGNDTKPEILQKASVGIIEQNTCNFLYNFSLTDRM
ICAGFMEGMVDSCQGDSGGPLACEVTPGVFYLAGIVSWGFGCAQAMRPGVYSRITEFTDW
ILDTISQLPSDGTSTPSSSAIPRTSAMAIFIQPSTMAASPTSRTTLETKMNRTMNETSTA
LRATETAKPTQTPVVPCTSLTFKCSSKVCIGKENPECDGVVDCSNGFDERNCDCGLTTAL
AFSKIVGGSSAAQGEWPWQVSLWLRRKEHKCGAVLIADRWLLSAAHCFDITLAGMICPTG
STHSLSEKCPCSYSDPKMWVAFLGTPFLSGINGKMEKIFRIYKHPFYNVYSLDYDVALLE
LSTPVKFSSTIRPICLPDNSHIFHEGARCFITGWGSTKEGGLMSKHLQKAAVNMIGDQAC
KKFYPVQISSRMLCAGFPQGTVDSCSGDAGGPLACKEPSGKWFLAGITSWGYGCARPYFP
GVYTKVTAVQGWIVQNLKL
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atggaccagataaagacagggcaaggcacccagagaaggagactgggggcctgctgctgg
aaggtaaccgctgctgctgctgtggtgggcagtgcaacagccctctgcctggggatcctg
ctcgcctgccattccacaggagaggccagctttgagcacacagtggagctgaaaggaatc
acattcaacagcagcttacagatggagaactcagactactatagggtgctgacacctgct
cttgaaagactgtttctatccagtctccaggactcccagctgaactggagttgcactggt
tgcactatcctgggctacagtaggaatggaaattccggtgtgatcgtccatttccgcctg
ctcttcactccccaggattcccaacccctgagctctaccttggaggaggaagctctgagg
catgggctggcagctgccctgcacaagcaggctttccccctggctgcctatgggaccatc
tcctcagcttctctcacaggtcccaacaaggtttcttcccacagacctggactgaaatca
gactgtgggagtcgccctgccatgcagactaccagcaggatagttggaggctcagaggcg
tccagaggggagttcccgtggcaagtcagcctacgagagaacaatgagcacttctgtggg
gctgcaatcctcacagagaagtggctggtgtctgctgctcactgctttactgagtttcag
gacccagccatgtgggcagcttacactgggaccacatccctcagaggctctgacagcagt
gcagtgaaaatggacatttcacagatcatcccacacccctcttacaatgctgacacagct
gactatgatgtggctgtgctggagctgaagagacctgtgactttcactaagtacatccag
cccgtgtgcctgccagatgctggccatcacttccccaccagcaagaagtgccttatttct
ggctggggctacctcaaggaggatttcttggtgaaacctgacttcctgcagaaagcaaca
gtggagcttctagaccagaacctatgttccagtctctacagtcatgtcctcacagacaga
atgatgtgtgctggctacctggaggggaaagttgactcctgccagggtgactctggtggg
cccctggtttgccaagaaccatctggcagatttttcctggcgggaattgtgagttggggt
attggatgtgccgaagccaggcgccctggggtttacacacgtgttaccaaactcagagac
tggatcttggatgctatttctgccttccctacctccatagcccatactgttcctccagta
cacttcaggactaacagtaacatggtcagtgctgaagaggtcaacaccaccactggagaa
actcccaccacctcaccagccccagctgccagcaggccagtgactgcagcaagaccacaa
gagtgtggaggacaacctgggttctctacacccagcaagattgtgggaggaacagatgct
tccagaggagagatcccttggcaagtcagcctgaaagaagactcaagacatttctgtgga
gccaccatcattggggaccgctggctgctgtcagcagctcactgcttcaatgagacaatg
ccagaagagatcgaagcctatgtgggaacaacatccctaaatggaacagatgagaatgca
gtgaaagtcagtgtaaaaagagtggtcccacatcccctcttcaaccccatgattctggac
ttcgatgtggctgtacttgaactggcaagacctcttgtcttcaacaaatacatacagcca
gtgtgcctcccacttgctgtgcagaagtttcctgttggcaagaaatgcctcatttctgga
tggggtgacctgcaggaagggaacgacaccaagcccgagatcctgcagaaagcctctgtg
ggcatcatagaacagaacacctgcaacttcctctacaacttctccctcactgaccgaatg
atctgtgctggcttcatggaggggatggtagactcatgtcagggagattcaggtgggccc
ttggcctgtgaggtgaccccgggagtgttttaccttgctggcatcgtgagctggggattt
ggctgtgcccaggctatgagacctggtgtgtactccagaattaccgaattcacagactgg
atcctggacaccatctcccaattgcccagtgatggcacaagcacaccttccagttcagcc
atccctagaacttctgccatggccatttttatccagcccagcacaatggctgcaagccca
accagcagaaccaccctggagacaaagatgaacagaaccatgaatgaaacttccacagct
ctgagagcaactgagactgcgaagcctacccaaaccccagtggtgccttgtaccagcctc
actttcaagtgttccagcaaggtgtgtattggaaaagaaaatcctgaatgtgatggtgtt
gtggactgcagcaatggtttcgatgagcgcaactgtgactgtggcctaacaactgctcta
gccttcagcaagattgtgggtggtagcagtgcagcccaaggagaatggccctggcaagtc
agtctgtggcttcggcggaaggagcacaagtgtggggctgttctcattgctgaccggtgg
ctgctctctgcagctcactgctttgacatcaccctggctgggatgatatgccccacagga
agcacacactccctatcagagaaatgcccctgcagttacagtgaccccaaaatgtgggtg
gcctttctaggaacacccttcctgagtggcatcaatggcaaaatggagaaaatattccgt
atctacaaacaccctttttacaacgtctacagcctagactatgatgtggcactactggaa
ctgagcacacctgtcaagttcagcagcaccatcagaccaatatgtctcccagacaattct
cacatcttccatgaaggggccagatgcttcatcacaggctggggctccacaaaggaagga
ggtctcatgtcaaagcatctgcaaaaagcggcagtgaacatgattggagaccaggcttgc
aaaaagttttaccctgtccagatcagcagcaggatgctgtgtgctggtttcccacagggc
accgtcgacagctgttcaggtgatgcaggtgggcccctggcatgtaaagaaccttcaggg
aagtggtttctagcaggaatcacaagctggggctatggctgtgccaggccatactttcct
ggcgtctacaccaaagtcacagctgtccagggctggattgtacagaacctgaagctctga

DBGET integrated database retrieval system