KEGG   Pseudomonas mandelii: OU5_0186Help
Entry
OU5_0186          CDS       T03626                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase class-II
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pman  Pseudomonas mandelii
Brite
KEGG Orthology (KO) [BR:pman00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OU5_0186
Enzymes [BR:pman01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     OU5_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C NAD_binding_8 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AHZ67265
UniProt: A0A024E3Z5
LinkDB All DBs
Position
226532..228094
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIIASLDDGAKSQEMLELLKDVASLSSQITLLDNGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDDRQIMAVPSIYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKEAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADKLVPGKNGEL
HEIHFASGATLKARTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVLGDGQ
KVNGLRYKDRQSDELRNVELEGIFVQIGLLPNTDWLKGTIELSPRGEIIVDARGETSMPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcgtacctggaacgggtcacccagccg
atcgagatcattgcttccctcgacgacggtgcgaaatcccaggaaatgctcgaactcctg
aaagacgttgccagtctttccagccagattactttgttagataacggtgacgatgcacgt
aagccatcgttctcgatcaatcgcccgggtgccgatatcagcctgcgttttgccggcatc
ccgatgggccatgaattcacttcgttggtgttggccttgctgcaagtgggcggccaccct
tcgaaggccagtgtcgaagtgatcgaacagatccgttcgctcaaaggcgagttcagcttc
gagacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtactgaacccgaacatccgccacgtcgccatcgacggcgcgttgttccaggcc
gaagtcgatgatcgtcagatcatggccgtgccaagcatttacctcaacggcgtgaacttc
ggccagggccgcatgggcctggaagaaatcctcgccaagatcgacaccagcggcatcgag
cgccaggccgagaaaatcagcgccaaggaagcctttgacgtattggtcgtcggcggtggc
ccggccggtgcttcggcagcgatctacgctgctcgtaaaggcattcgcaccggtgtggcg
gctgagcgctttggtgggcaggtgctcgacaccatggccatcgagaacttcatctccgtg
caggaaaccgaaggcccgaaactggcagtagcgctggaagaacacgtcaagcaatacgac
gtcgacatcatgaacctgcaacgcgccgacaaactggtgccgggcaagaacggtgagttg
cacgagatccacttcgccagtggcgcgaccctgaaagccaggaccgtgatcctcgcgacc
ggtgcgcggtggcgtgaaatgaacgtcccgggcgagcagcaataccgcaacaaaggcgtg
gcgtactgcccgcactgcgacggtccgctgttcaaaggcaagcgcgtggcggtgattggc
ggcggtaactccggcgtcgaagcggccatcgacctggcgggcatcgtgtcccacgtcaca
ttgctggagtttgacgtacaactgcgcgccgacgcggtcttgcagcgcaagttgcacagc
ctgccgaacgtcactgtgatcaccagtgcgcaaaccactgaagtgttgggcgacggtcag
aaggtcaatggcctgcgttacaaggatcgtcagtctgacgagctgcgtaatgtagagctg
gaagggatcttcgtgcagatcggtttgctgcccaacaccgattggctcaaaggcaccatc
gagctgtcgcctcgcggcgagatcatcgtcgatgcccgtggtgaaacgtcgatgccgggc
gtgtttgctgccggtgacgtcaccaccgtgccgtacaagcagatcgtgattgcagtgggc
gagggcgccaaggcttcgctgagcgcattcgatcacctgatccgcacctccgcgccggct
taa

DBGET integrated database retrieval system