KEGG   Pseudomonas mandelii: OU5_0595Help
Entry
OU5_0595          CDS       T03626                                 

Definition
(GenBank) Alpha amylase, catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pman  Pseudomonas mandelii
Pathway
pman00500  Starch and sucrose metabolism
pman01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OU5_0595
Enzymes [BR:pman01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     OU5_0595
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     OU5_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH Mak_N_cap YfcL
Motif
Other DBs
NCBI-ProteinID: AHZ67674
UniProt: A0A024E414
LinkDB All DBs
Position
complement(704775..708116)
Genome map
AA seq 1113 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHPDYGTMADAKRFISEAHKRGLRVITELVINHTSDQHA
WFQRARKAKPGSAARDFYVWSDDDHKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDTDKKGLNGDECHMAFHFPLMPRMYMALAQEDR
FPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRR
RLAPLMERDRRRVELLNSLLLSMPGTPTMYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRN
GGFSRADPASLVLPPIMDPQYGYLSVNVETQAGDPHSLLNWTRRMLAVRKQSKAFGRGTL
KMLSPSNRRILAYTREYDGPDGKYEIILCVANVSRSAQAAELDLSAYAGMVPVEMLGGNA
FPPIGQLNFLLTLAPYGFYWFGLAAENQMPSWHVEPAQSLPDFTTLVLKKRMEELLEAPS
RGTLEQGILPNWLQNRRWFAGKDAAIEKVNLVYGVRFGDAQHPVLLSEIEVTSGGQTSRY
QLPFGFIADDQVGPALPQQLALSRVRRGPQVGLITDAFSLENFIRAVLRGMQENTVLPSD
GGEIRFEPTEELAKLGLTAESEVRYLSAEQSNSSVVIGSSLVLKLIRKVASGVHPELEMS
AYLTNAGFSNISPLLGSVVRRDAKGEDNLLMIAQGYLSNQGDAWEWTQNNLERALRDELA
DAMSEQEQHYNALGELKDFAGMLGQRLGEMHQVLAAPTDDPDFAPQVTTQKEALASAKDV
AAQLEHSLKLLKQHQSELNPADKALVTRLLDNKKAILSHVQDLGEKAVGGLRIRVHGDLH
LGQVLVIKGDAYLIDFEGEPARPLSERRGKHSPYKDVSGVLRSFDYAAAMAINVNNVDNT
AEARAARQRVADRYLNEAKQAFVDAYRLAAASLAHAWQDPEGEDAALALFGLEKAAYEVA
YEAENRPTWLPVPLHGLYGLLSGLKPFSELGGE
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggcagccacctttatcaaggacccgctctggtacaaggatgcg
gtgatctaccaggttcacgttaagtcttttttcgactccaataacgacgggatcggcgac
tttcccggccttatcgccaaactcgattacattgccgacctcggcgtcaacaccatctgg
ctcttgccgttctatccgtcgccacggcgcgatgatggctacgacattgccgaataccgt
ggcgtccaccccgattacggcaccatggccgacgccaaacgtttcatctccgaggcccac
aaacgcggcctgcgggtgattaccgagctggtcatcaaccacacctccgaccagcacgcc
tggttccagcgcgcacgaaaagccaaacccggttcggccgcgcgggacttctacgtctgg
tccgacgacgatcacaaatacgacggcacccgcatcatctttctcgacaccgaaaagtcc
aactggacttgggacccggtcgccggccagtacttctggcaccggttctattcgcaccag
ccagacctcaacttcgacaacccgcaagtcatgaaagcggtgctatcggtgatgcgctac
tggctcgacatgggcatcgacggcctgcgcctggacgcgattccctacctgatcgagcgc
gacggcaccaacaacgaaaacctgcccgagacccacgacgtcctcaagcagatccgtgcc
gagatcgacgccaactatccagaccgcatgctcctggccgaggccaatcaatggccggaa
gacacgcagctgtacttcggtgacaccgataaaaaaggcctcaacggtgatgaatgccac
atggcctttcacttcccgttgatgccgcgcatgtatatggcgctggcccaggaagatcgc
ttcccgatcaccgacatcctgcgccagactccggagatcccggccaactgtcagtgggcg
attttcctgcgcaaccacgatgagttgaccctggaaatggtcaccgacaaggagcgcgat
tacctgtggaactactacgctgccgaccgtcgggcgcggatcaacctcggtattcgccgc
cgcctcgcaccgttgatggaacgggatcgccgtcgggtggaactgctcaacagtctgctg
ctgtcgatgccgggcacaccgacgatgtattacggcgatgaaatcggcatgggcgacaac
atctacctcggcgaccgtgacggcgtacgcacgcccatgcagtggtcgatcgaccgtaac
ggcggtttttcccgcgccgacccggcgagcctggtactgccgccgatcatggacccgcaa
tacggttacctgtcggtcaatgtcgagacccaggccggcgacccgcattcgctgctgaac
tggacccggcgcatgctcgccgtgcgtaagcagtccaaggccttcgggcgtggcacgctg
aaaatgctctcgccgagcaaccggcgaattctggcctacacccgtgaatacgacgggccg
gacggcaaatacgaaatcatcctgtgtgtggccaacgtatcgcgcagtgcgcaagcggcg
gagctggacctgtcggcttacgccggtatggtgccggtggagatgctcgggggtaacgcg
ttcccgccgatcggccagttgaatttcctcctgacgctggcgccttacggcttttattgg
tttggacttgctgcggagaatcaaatgcccagctggcacgtagaaccggcgcaaagcctg
ccggatttcaccaccctggtgttgaaaaaacgcatggaagaactgctcgaagcgccgtca
cgcggcacgctggagcagggcatcttgccgaactggctgcaaaaccgtcgctggttcgcc
ggcaaggacgcggccatcgagaaggtcaacctggtctatggcgtgcgcttcggcgatgcg
cagcatccggtgttgctcagtgaaatcgaagtcaccagcggcggccagaccagccgttac
cagctgccgttcggcttcattgccgatgatcaggtcgggccggcgttgccgcagcaactg
gcgctgtctcgggttcgacgtggccctcaagtggggttgatcaccgacgcattcagcctg
gaaaacttcatccgcgcggtgctgcgaggcatgcaggaaaacaccgtgttgccttccgat
ggcggcgagatccgtttcgagccgaccgaggagcttgccaaactgggcctgacggccgaa
tccgaagtgcgctacctgtcggccgagcagtccaacagttcggtggtgatcggcagcagc
ctggtgctgaagctgatccgcaaggtcgcctcgggcgtgcacccggaactggaaatgagc
gcctatctgaccaacgccggttttagcaacatctcgccgctgctggggtcggtggttcgc
cgcgacgccaagggcgaggacaatctgctgatgattgcccaaggctatttgagcaatcag
ggcgatgcctgggaatggacccagaacaacctcgaacgggcactgcgcgacgaactggcc
gacgccatgtccgagcaggagcagcactacaacgcactgggtgagctcaaagacttcgcc
ggcatgctcggccaacggctgggtgagatgcaccaggtgctggcagccccgaccgatgac
ccggacttcgccccgcaggtcaccacgcaaaaagaggccctggcctcggccaaggacgtc
gcggcgcaactggagcactcgctgaagttgctcaaacagcatcaaagcgaactgaacccg
gcggacaaagcgctggtcactcgtttactggacaacaaaaaagccatcctcagtcatgtc
caggacctgggcgaaaaagccgtcggtggtttgcgcattcgcgtccacggcgatttgcac
ctgggtcaggtgctggtgatcaagggcgacgcctacttgatcgacttcgaaggcgagccg
gcacggccgctgagcgaacgacgcggcaagcacagcccgtacaaagatgtcagtggcgtg
ttgcgctccttcgattacgccgcggcgatggcgatcaacgtgaataacgtcgacaacacc
gccgaagcccgagcggcacggcaacgagtagccgaccgttatttgaatgaagcaaaacag
gcatttgtcgacgcttatcggctggcggcagctagtcttgctcatgcgtggcaagatccg
gaaggcgaggacgccgcgttggcgttgttcgggctggagaaggcggcgtatgaggtggcc
tatgaggctgaaaatcgccccacgtggctgccggtgccattgcacggtttgtatggatta
ttgagtgggcttaaacccttttccgagcttggtggagagtag

DBGET integrated database retrieval system