KEGG   Pseudomonas mandelii: OU5_0961Help
Entry
OU5_0961          CDS       T03626                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pman  Pseudomonas mandelii
Pathway
pman00061  Fatty acid biosynthesis
pman00620  Pyruvate metabolism
pman00640  Propanoate metabolism
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01120  Microbial metabolism in diverse environments
pman01130  Biosynthesis of antibiotics
pman01200  Carbon metabolism
pman01212  Fatty acid metabolism
Module
pman_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OU5_0961 (accC)
   00640 Propanoate metabolism
    OU5_0961 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OU5_0961 (accC)
Enzymes [BR:pman01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     OU5_0961 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     OU5_0961 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK LpxI_N ATP-grasp_5 LAL_C2
Motif
Other DBs
NCBI-ProteinID: AHZ68040
UniProt: A0A024E617
LinkDB All DBs
Position
complement(1102401..1103774)
Genome map
AA seq 457 aa AA seqDB search
MTQGIRKLLIANRGEIAVRIIHAAKALGIPTVAACSEADVDSQAARMADEVHILGPARAD
KSYLNVEALLGALKTTGANAVHPGYGFLSENADFAEAVLAAGAIFVGPSPDTIRRMGDKA
EARRTAQAAGVPVVPGSPGELFDVESALEAAEAVGFPLLIKASAGGGGRGIRLAENAQQL
TEEFPRSQREAQAAFGNGAVYLERFISKARHIEVQVLGDGQHAVHLFERECSLQRRRQKI
FEEAPSPVLSQQQRETLCASAVRLTESLGYKGAGTLEYLYDDATGEFFFIEMNTRIQVEH
PVSELITGIDLVQAMLRIAGGEPLGFKQSDIQLNGAALQMRLNAEDPARDFFPSPGLVEE
LIWPQGEGIRVDTHLYQGYRVPPYYDSLLAKLIVHGADRAEALARARVAVRRTTLTGMAS
TLSLHGVLLEQPWLHSADFHTGTLETWLAELRFGGEV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaggtattcgtaaattattgattgccaaccgtggcgagatcgccgtgcggatt
atccacgccgccaaagcgttggggatccccaccgttgcggcatgcagcgaggcagacgtc
gattcccaggccgcgcgcatggccgatgaggtccacatcctcggcccggcccgtgcggat
aaaagttacctgaacgtcgaagcgttgctcggtgccttgaaaaccaccggcgccaatgca
gtacaccccggttatggttttctctcggagaacgccgattttgccgaagcggtccttgcc
gccggcgccattttcgtcggcccgagcccggacacgattcggcgcatgggcgacaaagcc
gaggcccgacgcactgcgcaagccgctggcgtgccggtggtgccgggttcccccggtgaa
ttgttcgacgtcgaatcggcgcttgaggccgccgaagccgtgggcttccctctgttgatc
aaagcctcggccggtgggggcgggcgcggcattcgcctggcggaaaacgcccagcaactg
acagaagagtttccccgctcacagcgtgaagcccaggccgcgtttggcaatggcgcggtt
tacctggagcggtttatcagcaaggcccggcacattgaagtgcaggtcttgggcgacggt
cagcacgccgtgcatttgtttgagcgggaatgttccctgcaacgtcgcaggcagaaaatc
tttgaagaagcgccgtcaccggtcctcagtcagcagcaacgggaaaccctctgcgccagc
gccgtgcgcctgaccgaatccctcggctacaagggcgccgggacgctggagtatctgtat
gacgacgccaccggcgagtttttctttatcgagatgaatacgcggattcaggttgagcac
ccggtcagcgaattaatcaccggcatcgatctggtccaggccatgttgcgcattgccggg
ggtgaaccgctgggcttcaagcaaagtgatatccagctcaacggcgccgccctgcaaatg
cgcctgaacgctgaagacccggcgcgggatttctttcccagcccggggctggtcgaggaa
ctgatctggccgcagggtgagggcattcgcgtcgatactcatctgtatcaaggctaccgt
gtgccgccgtactatgactcgctgctggccaagctgatcgtgcatggcgctgatcgcgcc
gaagccctggcccgagcgcgggttgcggtaaggcgaaccacgctcactggcatggccagc
accttgtccctgcacggcgtactgctggagcaaccgtggctgcacagcgccgactttcac
accggcaccctggaaacctggctggccgagctccgtttcggaggtgaagtatga

DBGET integrated database retrieval system