KEGG   Pseudomonas mandelii: OU5_1322Help
Entry
OU5_1322          CDS       T03626                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pman  Pseudomonas mandelii
Pathway
pman00010  Glycolysis / Gluconeogenesis
pman00052  Galactose metabolism
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01120  Microbial metabolism in diverse environments
pman01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OU5_1322
   00052 Galactose metabolism
    OU5_1322
Enzymes [BR:pman01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     OU5_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHZ68401
UniProt: A0A024E702
LinkDB All DBs
Position
1489565..1490713
Genome map
AA seq 382 aa AA seqDB search
MLHSRHLLSGLGLSLMIATLPTQAAGLSSEHKAFGKTNDGTPVEQYVLRNSHGLQATIIT
YGGILQSLKVPDKNGKLDDVVLGFDDVQGYQSGTAYFGATIGRFGNRLANGAFELDGKRY
QVPLNDGSNSLHGGPQGFDKHVWKAQPSKGKDSVGVTLTYLSADGEMGFPGNLKTEVTYS
LTENNELRIDYKASTDKPTVLNLTNHSYFNLAGAGNGDVLKQLVTLHSTHYTPVTAKLIP
TGELAPVAGTPMDFTQPTAIGKNIKADHPQLKFAEPKQGGFDFNWALDAKGDVGKLAADV
SDPLSGRRLQLYTTEPGVQFYTSNFLDGTVKGKGGKVYPHWGAFTLETQHYPDSPNQPNF
PSTRLDPGKTYTQSTVLKFSAH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgctgcactcccgacacctgctctccggcctcggactgtccctgatgatcgccaccctc
cccactcaagcggctggcctgtccagcgaacacaaagccttcggcaagaccaacgacggc
acacccgtcgagcaatacgtcttgcgcaacagccatggcctgcaagccacgatcattacc
tacggcggcattttgcagtcgctgaaggtgccggacaaaaacggcaagctcgacgacgtg
gtgctgggttttgacgacgttcagggctatcagagcggcaccgcttactttggcgcgacc
atcgggcgtttcggcaatcgcctggccaacggcgcgttcgaactggacggcaaacgctat
caggtgccgctcaacgacggctccaactcgctgcacggcggcccgcaagggtttgacaag
cacgtgtggaaagctcagccgagcaaaggcaaggattctgtgggcgttaccctgacctat
ctgtcggcggacggcgaaatgggcttccccggcaacctcaagaccgaggtcacttacagc
ctcaccgagaacaatgaactgcgcatcgactacaaggccagcactgataaaccgaccgta
ctgaacctgaccaatcacagctatttcaacctcgccggcgcgggcaacggggatgttctg
aaacagctcgtcaccctgcattcgacccattacacgccggtcaccgccaaactgattccg
accggcgaactggccccggtcgcgggtacgccgatggacttcacacaacccaccgccatc
ggcaaaaacatcaaggccgatcacccgcaactgaaattcgccgagccgaaacagggcggc
tttgacttcaactgggccctggacgccaagggtgatgtgggcaagctggcggccgatgtc
agcgacccactctccgggcgccgcttgcagctctacaccactgaacccggcgtgcagttc
tacaccagcaacttcctcgatggcacggtcaagggcaagggcggcaaggtttatccgcat
tggggcgcgtttaccctcgagacccagcactacccggactcaccgaaccagccgaacttc
ccgtccacccgacttgacccgggcaagacctatacccagagcactgtgctgaagttttca
gcccactaa

DBGET integrated database retrieval system